KEGG   Clostridium botulinum A Hall: CLC_1702Help
Entry
CLC_1702          CDS       T00575                                 

Definition
(RefSeq) UbiE/COQ5 family methlytransferase
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Ubie_methyltran Methyltransf_23 Methyltransf_12 CMAS Methyltransf_9 MTS Methyltransf_2 Methyltransf_8 Methyltransf_4 GidB Methyltransf_17 PCMT Bin3 DOT1 MetW DUF2313 Methyltransf_29 PrmA GCD14
Motif
Other DBs
NCBI-GeneID: 5398891
NCBI-ProteinID: YP_001387558
UniProt: A5I2N1
Position
1797032..1797667
Genome map
AA seq 211 aa AA seqDB search
MKNLMNKVYGQFRRPKGMIGKFIAKSMNKEHFKVTTWGLHKLKVKDSNIILDIGCGGGRT
VNRLAHGVPKGKVFGMDYSLDCVNFSKKYNKDLIENGKVEIIHGSVDKMPFEDDKFDIIS
AVETTYFWPNLLDSFKEVKRVLKPSGKFIIVNASYTNEKFKERNEEYLRKVPGMKIYSVD
YIKNLLEEVGYKNISIETLEEENWLCAIGEK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaatgaataaagtttatggacaatttagaaggcctaaaggaatgataggt
aaatttattgcaaaaagtatgaataaagaacactttaaagtaactacttggggacttcat
aaacttaaagtaaaagatagtaatatcatattagacataggctgtggaggaggaaggact
gtaaacagacttgctcatggagttccaaaaggaaaggtttttggcatggattattcttta
gattgtgtgaatttttctaaaaaatataacaaagatttaatagaaaatggcaaagtagag
attattcatggtagtgtagataaaatgccctttgaagatgataaatttgatattatatct
gcagtagaaactacatatttttggccaaatttattagacagttttaaggaagtaaaaaga
gtactaaaaccttcaggaaagtttattatagtaaatgctagttatactaatgaaaaattt
aaagaaagaaatgaagaatatctaagaaaagtaccaggtatgaaaatatatagtgtggat
tatataaaaaacttattagaagaagtgggatataagaatatatccatagagaccttagaa
gaggaaaattggctatgtgccataggagaaaaatag

DBGET integrated database retrieval system