KEGG   Clostridium botulinum A Hall: CLC_1705Help
Entry
CLC_1705          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N HTH_Tnp_1_2 TetR_C_10 HTH_19 Terminase_5 HTH_7 HTH_Tnp_4
Motif
Other DBs
NCBI-GeneID: 5398702
NCBI-ProteinID: YP_001387561
UniProt: A5I2N4
Position
1799941..1800504
Genome map
AA seq 187 aa AA seqDB search
MKQKILDITSKNIELYGLKKFTMDDISYDLKISKKTIYKYFKSKNDLISQYFNEIIDSDK
KSTLELLEKKMPLDEKLYNIIYSYHKYKLSVRILDEAYKFYPEEFKKIQEFKDFKIDLVK
KILREGKNQGVIEENININIVSLILEKVSDTFLDYKFLTNNNITMKQAMVDLMNILLNGI
LNENYNG
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaaatattagatataacctctaaaaatatagaattatatgggttgaaaaaa
tttaccatggatgatatatcctatgatcttaaaataagtaaaaaaaccatatacaagtat
tttaaaagtaagaatgatctaataagccaatattttaatgaaataatagacagtgataaa
aaaagcactttagaattattagaaaagaaaatgcctttagacgaaaaattatataatata
atctattcttatcataaatataaattatcagtaaggattttggatgaagcttataaattc
tatcctgaggaatttaaaaaaattcaagagtttaaagattttaaaatagatttagtaaaa
aaaattttaagagaaggtaaaaatcaaggggtaatagaagaaaatataaatataaatata
gtaagtttaattttagaaaaagttagtgatacatttttagactataaatttttaactaat
aataatattactatgaaacaagccatggtagatttgatgaatatactattaaatggtatt
ttaaatgaaaattataatgggtaa

DBGET integrated database retrieval system