KEGG   Clostridium botulinum A Hall: CLC_1712Help
Entry
CLC_1712          CDS       T00575                                 

Definition
(RefSeq) PfkB family kinase
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 5399931
NCBI-ProteinID: YP_001387568
UniProt: A5I2P1
Position
1806080..1807039
Genome map
AA seq 319 aa AA seqDB search
MNYYCNNEPYVLVFGASVVDIFGFSCCDYRAYNSNPGKIKISFGGVCRNIAENLSRVGIN
TKFISILGEDENAKCMLEHSRKMGYDMGDSLILKGGTTPTYMAILDENGEMVSAVADMKS
IGEMNSEFIDSKADIIKKAEYTVLDSDNPEILEYILKKFKGKTKFILDPVSAEKAKNIKP
LIKYFHTIKPNIHEAEVLSGFKIETIEDLKKAGEYFESLGVENVFISLDAEGIYYKNKFE
EGRIKAKDVTVKNVTGAGDAFVAGIAYGYMNKLSLEETVKFAITMANLTIAHENTINPDL
SYNIVENNIKNIQWIEEYL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaattattattgtaataatgaaccatatgttttagttttcggagcatcagtagtagat
atttttggttttagttgttgcgattatagagcttacaattctaatccgggtaaaataaaa
atatcctttggtggagtatgtagaaatatagcggaaaatttatcaagagttgggattaat
actaaatttatatctatattaggtgaggatgaaaatgctaaatgtatgttagagcattca
agaaaaatgggatatgatatgggagactctcttattttaaaaggaggtacaacccctact
tatatggccatattagatgaaaatggagaaatggtttcagcagtggctgatatgaaaagt
ataggcgaaatgaattccgagtttatagattcaaaggcggatataataaaaaaggcagag
tatacagttttggattcagataatcctgaaatattagaatatatattaaaaaagttcaaa
ggaaaaacaaagtttatattggatcctgtttctgctgaaaaagctaaaaatataaagcct
ttaataaaatattttcatactattaaacctaatatacatgaagcagaagttttatcaggt
ttcaaaatagaaactatagaagatttaaagaaagcaggagagtattttgaatctttaggt
gtagaaaatgtttttataagtttagacgcagaaggaatctattataaaaataaatttgaa
gagggaagaataaaggctaaggatgttacagtcaaaaatgttacaggagcaggagatgcc
tttgtagcaggtatagcatatggttatatgaataaattatctttagaggaaactgtaaag
tttgctataactatggctaatttaactatagctcacgaaaacactataaatccagattta
agttataatattgtagagaataatataaaaaatattcaatggattgaagaatacttataa

DBGET integrated database retrieval system