KEGG   Clostridium botulinum A Hall: CLC_1714Help
Entry
CLC_1714          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5401279
NCBI-ProteinID: YP_001387570
Position
complement(1808221..1808640)
Genome map
AA seq 139 aa AA seqDB search
MNNENNKKDIAIEDIEDIENIDSLINLSDDCIEKTLIRIRSINALRDELIKLNLNPEGLI
YFNNEVYPLLYTLTNLSTTSLNLSTSANFLSTAVYLKPKDSKIKDTLKLIYEMTEQCEDI
YDSLKYKIDTLICISKKSK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgaaaataataaaaaagatattgctatagaagatatagaggatatagaaaat
atagatagtttaataaacttatctgatgattgtatagaaaaaacattaattaggataaga
agtataaacgctttaagagatgaactaattaaactcaatttaaatccagaagggttaatt
tattttaataatgaagtttatcctttactttatactttaacaaatcttagcaccacttct
ctaaatctatctacttctgctaattttctatcaactgctgtatatttaaagcctaaggat
tctaaaattaaggatactcttaaattaatctatgaaatgactgagcaatgcgaagatata
tacgattctttaaaatataaaatagatactcttatatgtatatctaaaaaatccaaataa

DBGET integrated database retrieval system