KEGG   Clostridium botulinum A Hall: CLC_1715Help
Entry
CLC_1715          CDS       T00575                                 

Definition
(RefSeq) cold shock protein
  KO
K03704  cold shock protein (beta-ribbon, CspA family)
Organism
cbh  Clostridium botulinum A Hall
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cbh03000]
    CLC_1715
Transcription factors [BR:cbh03000]
 Prokaryotic Type
  Other transcription factors
   Others
    CLC_1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD Rho_RNA_bind OB_RNB
Motif
Other DBs
NCBI-GeneID: 5400861
NCBI-ProteinID: YP_001387571
UniProt: A5I2P4
Position
1808987..1809196
Genome map
AA seq 69 aa AA seqDB search
MSMHTGTVKWFDNERGYGFIAGNNGKDVYVHSMQIKEKTLNKDLHEGEEVLFDIVEKEKG
PIAINVQKL
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgcatacgggaacagttaaatggtttgacaatgaaagagggtatggttttata
gcagggaataatggaaaagatgtatatgttcactctatgcagataaaagaaaaaactctt
aataaggatttacacgagggtgaagaggtactatttgatatagtagagaaagaaaagggg
cctatagctataaatgtacaaaagctatag

DBGET integrated database retrieval system