KEGG   Clostridium botulinum A Hall: CLC_1721Help
Entry
CLC_1721          CDS       T00575                                 

Definition
(RefSeq) DEAD/DEAH box helicase
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII AAA_30 Terminase_6 Flavi_DEAD AAA_19 Peptidase_C93
Motif
Other DBs
NCBI-GeneID: 5399023
NCBI-ProteinID: YP_001387577
UniProt: A5I2Q0
Position
1817060..1818325
Genome map
AA seq 421 aa AA seqDB search
MNNSFDTLNLNPKLVQGLKKLNINIPTEIQAEAIPLAMENKDIIGQSETGTGKTLAYLLP
IFEKITTEKREMQAIILAPTHELAMQINNEIKNISSNSNMDVKSMAIIGEANIKRQIEKL
KEKPHIIVGSPGRILELIKKKKITAHTVKTIVIDEGDKLLDKNNLKVVKEVIKTTLRERQ
LMLFSATITESTLNIAKDLMKDSVIVKVKEKNTVNENIKHLYITGEHRERIEILRKLIAA
TNPKRAIVFINRNEEIELTTLKLQYHKIKAYGIYGAAEKEQRKKALEDFRSGKVQILVSS
DLSARGLDVKDVTHIFNLDLPENPKEYLHRVGRTGRASKEGIAISIITEKEKALIRKYEK
EFNINIEEKKIYKGTLISSKGERSSQPKSKNKSTSAHKDNNKKKRSSSINKSKNNHKKKK
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaataattcatttgatacattaaatttgaatcctaaattagttcagggactaaaaaag
ttaaatataaatatacccacagaaattcaagctgaagctatacctttagctatggaaaat
aaagatataataggtcagtcagaaacaggtacgggaaaaactttagcctatttattgcct
atatttgaaaaaataactacagaaaaaagagaaatgcaagctattatattagctcctacc
catgagttagctatgcaaataaataacgaaataaaaaatatatcttcaaattcaaatatg
gatgtaaaatctatggctataataggagaagcaaatataaaaagacagattgaaaaatta
aaagaaaagccacatattattgtggggtctccaggaagaatattagagcttataaagaaa
aaaaagataactgcccatacagttaaaactatagttatagatgagggagataaactttta
gataagaataatttaaaagtagtaaaagaggtaataaaaacaactctaagagaaagacag
ttaatgttattttcagccacaataactgaatctactttaaatattgcaaaggatttaatg
aaagattcagtaatagtaaaagttaaagaaaaaaatactgtaaatgaaaatattaagcat
ttatatattactggagagcatagagaaagaattgaaattttaaggaaacttatagcagct
acaaatcctaaaagagctattgtatttataaatagaaatgaagaaatagaattaactaca
ctaaaacttcaatatcataaaattaaagcctatggtatatatggtgctgcagaaaaagag
caacgtaaaaaagctttagaagattttagatcaggaaaagttcaaatattagtttcatca
gatttatccgccagagggctggatgtaaaagatgtaactcacatattcaatttagattta
cctgaaaatccaaaggaatatttgcatagagtaggaagaacaggaagagcttctaaggaa
ggaattgctatttcaataataacagaaaaagagaaagcattgataagaaagtatgaaaaa
gagtttaatattaatatagaggaaaaaaagatttataaaggaactttgattagttctaaa
ggagaaagatctagccagccaaagagtaaaaacaaatctacttcagcacataaagataat
aataaaaagaaaagaagtagttctataaataaatcaaaaaacaaccataaaaagaaaaaa
tattaa

DBGET integrated database retrieval system