KEGG   Clostridium botulinum A Hall: CLC_1722Help
Entry
CLC_1722          CDS       T00575                                 

Definition
(RefSeq) RNA-binding protein
  KO
K00243  uncharacterized protein
Organism
cbh  Clostridium botulinum A Hall
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CLC_1722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S1_2 S1 DUF3006 DUF2582 HTH_24 5_nucleotid
Motif
Other DBs
NCBI-GeneID: 5399694
NCBI-ProteinID: YP_001387578
UniProt: A5I2Q1
Position
1818648..1819484
Genome map
AA seq 278 aa AA seqDB search
MIKLGEIQKLEIIREAPMGVYLNSKEDKSENDILLPGKQVPKDAKIGDEVEVFVYRDSED
RMIATINRPKITIGEIATLKVIEKTKMGAFLDWGLERDLFLPFKEQTYGIQEGMECLVYL
YIDKSDRLCASMNVYRVLSTESPYKEDDEVKGFIYDIKREIGAFVAVDNEYHGLIPKNEL
YGKFRYGDIVEARVTKVKEDGKLDLSIRKKAYKQMDEDVDTILEKLNSNGGKLYLNDNSD
PRAIKELLNMSKNAFKRAVGRLLKEGKIEFIEKGIKLK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgataaagttaggtgaaatacaaaagttagaaataataagagaggctcctatgggagta
tatttaaattctaaagaggataaaagtgaaaatgatatattattacctggaaaacaagtg
cctaaagatgctaaaataggtgatgaagtagaagtctttgtttatagggattcagaagat
aggatgatagctaccataaataggcctaaaataactattggggaaatagctactttaaag
gttatagaaaaaactaaaatgggagcttttctagactggggactagaaagagatttattt
ttaccatttaaagaacaaacttacggtatacaggaaggaatggaatgtttagtttattta
tacatagacaaaagcgatagactatgtgctagtatgaatgtatatagagtattaagtaca
gaatccccttataaagaggatgatgaagttaaagggtttatatatgatataaaaagagaa
ataggagcttttgttgctgtagacaatgaataccatggattaatacctaaaaatgaatta
tatggaaagtttagatatggagatatagtggaggctagagtaactaaagtaaaggaagat
ggtaaactagatttaagtattagaaaaaaagcatacaaacaaatggatgaggatgtagat
actattttagaaaagctaaattctaatggcggtaagctttatttaaatgataatagtgat
ccaagagctataaaggaacttttaaatatgagtaaaaatgcatttaaaagagcagtagga
agacttttaaaagaaggtaaaatagaatttattgaaaagggcattaagcttaaataa

DBGET integrated database retrieval system