KEGG   Clostridium botulinum A Hall: CLC_1731Help
Entry
CLC_1731          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gate
Motif
Other DBs
NCBI-GeneID: 5401432
NCBI-ProteinID: YP_001387587
UniProt: A5I2R0
Position
complement(1834076..1835434)
Genome map
AA seq 452 aa AA seqDB search
METQKNNKYSFSELFKFICPSLIGFILFIIPISYDGEITIPIAVLSKIVLAGLGSILPQL
MGIIICITFICTAITKIFKPKAILENKFFNNLFNVSPVWVLARILGFIFIVSTFFKIGPE
WMWSKNTGGLLLYDLLPILFSVFIFAGMLLPLLLDFGLLEFVGALLTKVMRPIFNLPGRS
SIDCMASWLGDGTIGVLLTSKQYEEGYYSEREAAVIGTTFSAVSITFSLVVISQVKLAHM
FVPFYLTVCLSGIIAAILIPRIPPLSRKPDTYLNGGESKNSEALPEGYTPFTWGLEKAVA
KAGSNGDPLNFIRQGLQNVLDMLLGVTPVVMAMGTSALILAEYTPLFKWLGLPFIPLLNL
LKIPEAALASQTIVVGFADMFLPSVIAATIQSEMTRFIIACLSVTQLIYMSEVGGLLLGS
KIPVSLKDLVIIFLERTLVTLPIITLVAHILF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
ttggaaactcaaaaaaataacaaatattcgtttagtgaattatttaaatttatttgccca
tccttaataggttttatactgtttataatacctatttcttatgatggagaaataacaata
cctattgctgtactttcaaaaattgttttagctgggttaggtagcatattacctcaactt
atgggaatcatcatatgcattacttttatttgtacagcaattacaaaaatatttaaacct
aaagctattttagaaaataaattttttaacaatttattcaacgtgtctcctgtatgggta
ctagctagaatattaggctttatatttattgtttctaccttttttaaaataggacctgaa
tggatgtggtcaaaaaacacaggaggcctattactttatgatttgcttcctatattattt
tcagtatttatatttgcagggatgttacttcctttattgttggactttggtttattagaa
tttgttggggcattacttactaaggtaatgagaccaatatttaatttaccaggacgttct
tctatagactgtatggcttcttggcttggtgatggtaccattggtgtattacttactagc
aaacaatatgaagagggttactatagcgaaagagaagctgcagttatagggacaaccttc
tcagcagtttctataacttttagtttagttgtaatatctcaggttaaacttgctcatatg
tttgtgcctttttatttaacagtttgcttatcaggtataattgctgctatcttaattcct
cgcataccaccactttcaagaaaaccagatacttatttaaatggtggagaaagcaaaaat
tctgaagctcttccagaaggatacacacctttcacatgggggcttgaaaaagctgttgct
aaagccggctccaatggtgatcctcttaattttataagacaaggattacaaaatgtattg
gatatgcttttaggcgtaactcctgtagttatggctatgggaacatctgctcttatatta
gctgaatataccccgctttttaaatggttaggtctaccttttataccactactaaaccta
ttaaaaataccagaagccgctttagcatcacaaactattgtagttggttttgcagatatg
ttcttaccttcagttattgcagccactatacaaagcgaaatgacaagatttataatagct
tgcctttcagttactcaattaatttatatgtctgaagtaggaggactattattaggttct
aaaatacctgtttcattaaaagatttggtcattatatttcttgaaagaacattagtaact
ttacctattattactttagtagctcacatattattttaa

DBGET integrated database retrieval system