KEGG   Clostridium botulinum A Hall: CLC_1733Help
Entry
CLC_1733          CDS       T00575                                 

Definition
(RefSeq) small, acid-soluble spore protein beta
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SASP
Motif
Other DBs
NCBI-GeneID: 5400222
NCBI-ProteinID: YP_001387589
UniProt: A5I2R2
Position
1836436..1836636
Genome map
AA seq 66 aa AA seqDB search
MANRNSNNLVVPEAKHGLNQLKMEVANEVGIANYDAVDKGNLTSRQNGYVGGNMVRKMVE
AYERNL
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatagaaattctaataatttagtagtgccagaggcaaaacatggattaaatcaa
ttaaaaatggaagttgcaaacgaagtaggaatagcaaactatgatgctgtggataaagga
aatttaacttcaagacaaaacggatatgtaggcggaaatatggttagaaagatggtagaa
gcttacgaaagaaatctataa

DBGET integrated database retrieval system