KEGG   Clostridium botulinum A Hall: CLC_1735Help
Entry
CLC_1735          CDS       T00575                                 

Gene name
xerC
Definition
(RefSeq) site-specific tyrosine recombinase XerC
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Phage_int_SAM_1 Phage_int_SAM_4
Motif
Other DBs
NCBI-GeneID: 5401500
NCBI-ProteinID: YP_001387591
UniProt: A5I2R5
Position
1838087..1839067
Genome map
AA seq 326 aa AA seqDB search
MKYNIQQLYDANFPQRLNDFLNYLRTIKGKSENTIESYKLDLIMFFRFLKLYKGMVPGET
EFNDIEIKDISDEDIKNISLTDLFAFVSFVENYRNNGSYAKARKVATLKSFFRFLQGKVK
IIKENPALELESPKISKRNPVYLTLDESKRLLSSIDGKFKERDLCIVTMFLNCGLRLSEL
CGINISNIKNDILTVVGKGNKERTVYLNKACIKTLNDYLNVRKEMGEKIVDKDALFLSKN
YTRINKRSVEMLVKKYVKKAGLDGEKYSPHKLRHTAATLMYKHGGVDIRSLQMILGHENI
STTQIYTHVDSDRLREAVKSNPLSDE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataatattcaacaattatatgatgctaattttccccaaagattaaatgatttt
ttaaattatcttagaactataaaaggaaaatcagaaaatacaattgaaagctacaaatta
gatttgattatgttttttagatttttaaaattatacaaaggtatggttcctggagagaca
gaatttaatgatatagaaataaaggatataagtgatgaagacattaagaatatatcatta
acagatttgtttgcttttgtatcctttgtagagaattatagaaataacggtagctatgct
aaagctagaaaagtagctacactaaaatctttctttagatttttgcagggtaaagttaaa
attataaaggagaaccctgctctagaattagaaagccctaaaataagtaaaagaaatcct
gtatatttaacattagatgagagtaaaaggctattatcttctatagatggtaagtttaaa
gaaagagatctatgcatagtgactatgttcttaaattgtggattgagactttcagaatta
tgtggtataaacatatctaatattaaaaatgatattttaaccgttgtaggtaaaggaaac
aaagaaagaactgtataccttaataaagcttgcattaaaactttaaatgattatttaaat
gtaagaaaagaaatgggagaaaaaatagtggataaagatgctctatttttaagtaaaaat
tatacaaggataaataaacgttctgtagagatgttagtaaagaagtatgtaaaaaaagca
ggtttagatggagaaaaatattctcctcataaattgagacatacagcagctacattgatg
tacaagcatggtggcgttgatataagaagtttacaaatgatattaggccatgaaaatata
tctacaacccaaatttacactcatgtagacagtgatagattaagagaagcagttaaatct
aatcctttaagtgatgaataa

DBGET integrated database retrieval system