KEGG   Clostridium botulinum A Hall: CLC_1737Help
Entry
CLC_1737          CDS       T00575                                 

Gene name
lexA
Definition
(RefSeq) LexA repressor
  KO
K01356  repressor LexA [EC:3.4.21.88]
Organism
cbh  Clostridium botulinum A Hall
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cbh01002]
    CLC_1737 (lexA)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cbh03400]
    CLC_1737 (lexA)
Enzymes [BR:cbh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     CLC_1737 (lexA)
Peptidases [BR:cbh01002]
 Serine Peptidases
  Family S24: LexA family
   CLC_1737 (lexA)
DNA repair and recombination proteins [BR:cbh03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    CLC_1737 (lexA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LexA_DNA_bind Peptidase_S24 HTH_24 HTH_5 MarR_2 HTH_20 HTH_IclR B-block_TFIIIC HTH_Crp_2 HTH_29 MarR TrmB HTH_28 HTH_27 FaeA HTH_36 HTH_12
Motif
Other DBs
NCBI-GeneID: 5399521
NCBI-ProteinID: YP_001387593
UniProt: A5I2R7
Position
1840161..1840766
Genome map
AA seq 201 aa AA seqDB search
MNKSRIDKQNEVYNFIKLQIKEKGYPPSVREICKAVGLSSTSSVHFHLKRLEKEGLIKRD
SSKTRAIEIVDPTSKKEVINVPIVGTITAGNPILAIENIEDVFPLPIDYVKNTKDLFMLK
VSGESMIEAGILNGDLAIIEKTDSANNGDIVVALIDNEATLKRFFKESSYIRLQPENKSM
KPIILENCKVLGRLVGIYRKY
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagccgaattgacaaacaaaatgaagtttataactttataaaattacaaatt
aaagaaaaaggctatcctccttctgtaagagaaatttgcaaggcggtaggtttaagctca
acttcatcagtgcattttcatcttaaaagattagaaaaagaaggtttaataaagagagat
agtagcaaaactagagctatagaaattgttgatcctacctcaaaaaaagaagttataaat
gtgcctattgtaggaactataactgcaggcaatcctattttagctatagaaaatatagaa
gatgtatttccattgcctattgattatgttaaaaacacaaaagatttatttatgctaaag
gtatctggagaaagtatgatagaagctggaatattgaatggagatttagctattattgaa
aaaaccgattctgcaaataatggagatattgtggttgctctaatagacaacgaagctact
ttaaaaagattttttaaagaaagctcttatataagacttcagcctgaaaataaaagtatg
aaacctataattttagagaattgtaaagttcttggaagattagtaggaatatatagaaag
tattaa

DBGET integrated database retrieval system