KEGG   Clostridium botulinum A Hall: CLC_1740Help
Entry
CLC_1740          CDS       T00575                                 

Gene name
miaA
Definition
(RefSeq) tRNA delta(2)-isopentenylpyrophosphate transferase
  KO
K00791  tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh01100  Metabolic pathways
cbh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cbh01006]
    CLC_1740 (miaA)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbh03016]
    CLC_1740 (miaA)
Enzymes [BR:cbh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     CLC_1740 (miaA)
Prenyltransferases [BR:cbh01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   CLC_1740 (miaA)
Transfer RNA biogenesis [BR:cbh03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CLC_1740 (miaA)
 Prokaryotic Type
    CLC_1740 (miaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IPPT IPT AAA_18 Cytidylate_kin AAA_33 RuvB_N AAA
Motif
Other DBs
NCBI-GeneID: 5401241
NCBI-ProteinID: YP_001387596
UniProt: A5I2S0
Position
complement(1842690..1843625)
Genome map
AA seq 311 aa AA seqDB search
MIDLLIIAGPTAVGKTDISIKLAEKLNGEIISADSMQIYKYMDIGSAKITKDEMKGIPHH
LIDVVEPHEEFNVSSFKALAEKSIKDIWNRGKLPIIAGGTGLYINSLIYNYDFTDADRDE
KYREYLTKLAEDKGKEYVHSLLKDIDKESYEKLYPNDLKRVVRALEVYKITGKSISEYTK
ENEKKLYDIPYNVNYFILNMNREVLYERINKRVDIMMGKGLIEEVKKLESMGYTPDMQSM
KGIGYKEVLFYLNGDISLDEAIYLIKKGSRNYAKRQLTWFRKDKRSIWIDKDKYRSEEEI
VDKIIKMVKDK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatagatttattaataattgcaggtcctacagcagtagggaaaacagatatttccata
aaacttgcagaaaaactaaatggagagataatatccgctgactctatgcaaatttataaa
tacatggatataggttcagccaaaataactaaggatgaaatgaagggaatacctcaccat
cttatagatgtagtagaaccccatgaagaattcaatgtatcttcctttaaagctctagca
gagaaatctataaaagatatatggaacagaggaaagttgcccataatagcaggaggtaca
gggttatatattaattctttaatatacaattatgattttacagatgcagatagagacgaa
aaatatagagaatatcttactaaattagcagaagataaagggaaggaatatgttcatagc
ctgctaaaagatatagataaagaatcctatgaaaagttatatcctaatgatctaaaaaga
gtagtaagagccttagaagtttacaaaatcacaggtaaatctataagcgaatacacaaaa
gaaaacgagaaaaaattatatgatatcccttataacgtaaactactttattttaaatatg
aatagagaggtactctatgaaagaattaataaaagagtggatataatgatgggtaaaggt
ttaatagaagaagttaaaaaattagagtccatgggatatactccagatatgcaatctatg
aaaggtataggttataaagaagttttattctatttaaatggagatatttcactagatgaa
gctatttatttaataaaaaaaggaagcagaaattatgctaaaagacaacttacttggttt
agaaaagataaaagatctatatggatagataaagataaatatagatctgaggaggaaata
gtagataaaattataaaaatggtaaaagataaatag

DBGET integrated database retrieval system