KEGG   Clostridium botulinum A Hall: CLC_1741Help
Entry
CLC_1741          CDS       T00575                                 

Gene name
mutL
Definition
(RefSeq) DNA mismatch repair protein
  KO
K03572  DNA mismatch repair protein MutL
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    CLC_1741 (mutL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cbh03400]
    CLC_1741 (mutL)
DNA repair and recombination proteins [BR:cbh03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Molecular matchmaker
     CLC_1741 (mutL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c Phage_CI_C
Motif
Other DBs
NCBI-GeneID: 5398361
NCBI-ProteinID: YP_001387597
Position
complement(1843641..1845641)
Genome map
AA seq 666 aa AA seqDB search
MRKINLLDLETTNKIAAGEVIERPFSVVKELVENSIDAGAKNITIEIEDGGQKLIKIIDD
GEGIYPIDIKNAFLPHATSKINSIEDIYKISTMGFRGEALASISSVSKTKLKSRVDSYNF
GKEIYIEGGKIEYLKDTGCNVGTTIEVSDLFYNVPARLKFLKSARSDSSSISDIVNRFIL
SHPDISFNLINKGKQSIKSYGTGNLKDSIRCVYNKTISENLINFESHKDIISVYGFIGKP
EISRKSRTNQSIFVNKRYVKSKFITAAVENAFKSFLTVNSYPFFVIFIDIFPEYIDVNVH
PTKSEVKFKDERAMFKTIFDAVHEAIKGELKESFTNFFNKEDINIYDSEKSITEPIKLEK
EEVQIPIDLNSNNKIDIFGNNINKLPNNTELLKNIGIKEKNTLENNNDFYTSKQNEIYYA
NKNDECLNSCNKDNYSKIEKSLQKDNKNPDILYLNEHNRNSSPINIKENKSNNFYVDMKI
IGQFNNTYILIEKDKELYIIDQHAAHEKVLFEKFKCEIEKGYVISQILLSPVVIELSEDE
FNIYEENKDIFKNSGFSVETFGEYTINIKEVPLILGKPNVENLFMDILYNLKNMKSKETS
TIKYNAIATLACKSAVKANDNLKEEEIKKLIEDMLILNNPYTCPHGRPTMIKFTLKDLEK
KFKRIQ
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaataaatttattagatttagaaactacaaataaaatagctgcaggagaagtt
atagaaagacccttttctgtagtaaaagaattagtagaaaatagtatagacgccggtgcc
aaaaatataaccatagaaatagaagatggaggacaaaagcttataaaaataatagatgat
ggagaaggtatttatcctattgatataaaaaatgcttttcttcctcatgctacaagtaaa
ataaattctatagaggatatatacaaaataagtactatgggctttagaggtgaagcacta
gctagcatttcttccgtatcaaaaactaaacttaaaagtagagttgactcttataatttt
ggaaaagaaatatatatagagggtggcaaaatagagtacttaaaagatacaggttgcaat
gttggcactactatagaagtttctgatttattttataatgtacctgcaagacttaaattt
ttgaaaagtgcaagaagtgatagtagttctatatcagatattgtgaataggtttatatta
tcccatccagatatatcttttaatttaataaataagggaaagcaaagtataaagagttat
ggtaccggaaatttaaaggactctatacgatgtgtatacaataaaacaataagtgaaaac
cttataaacttcgaaagtcataaagatataatatctgtatatggatttataggtaagcct
gaaataagccgtaaaagcagaacaaatcaaagtatatttgtaaacaagcgatatgttaaa
agtaaatttataactgctgcagtagaaaatgcttttaaatcctttttaacagtaaatagc
tatcctttctttgtaatatttatagatatttttccggaatatattgatgtaaatgtacat
cctactaaatcagaagttaaatttaaagatgagagagctatgtttaaaactatatttgat
gcagttcatgaagccataaaaggagaattaaaagaatcctttacaaacttctttaataaa
gaagatattaatatatatgattctgaaaaatctataactgaacccataaaactagagaaa
gaagaagtacaaataccaatagatttaaatagtaataataaaattgatatttttggtaat
aatataaataaactacctaacaatacagaacttcttaaaaatataggtattaaagaaaaa
aatacacttgaaaataataatgatttctatacttctaaacaaaatgaaatatactatgct
aataaaaatgatgaatgtttaaattcatgtaataaagataactatagcaaaatagaaaag
tcattacaaaaagataataaaaatccagatatcttatatctaaatgagcacaatagaaat
tcttcacctataaatattaaagaaaataaatctaataatttttatgtagatatgaaaata
ataggacagtttaataatacatatatattaatagaaaaggataaagaactttatataata
gatcaacatgcggctcatgaaaaagtgttatttgagaaattcaaatgcgaaatagaaaag
ggatatgtaataagtcagattttattatctcctgtagttatagaactttcagaagatgaa
tttaatatatacgaagaaaacaaggatatttttaagaattcaggtttttcagtggaaact
tttggagaatacactataaatataaaagaagtacctttaattctaggtaaacccaatgta
gaaaatctctttatggatatactttataatttaaaaaatatgaagtctaaagaaacttct
acaataaaatataatgccattgctacactggcatgcaaatccgcagttaaagctaatgac
aacttaaaagaagaagaaataaaaaaattaatagaagacatgcttatattaaataatcca
tatacttgtccccatggaagacctactatgattaaatttacattaaaagatttagaaaaa
aaatttaaaagaatacaatga

DBGET integrated database retrieval system