KEGG   Clostridium botulinum A Hall: CLC_1743Help
Entry
CLC_1743          CDS       T00575                                 

Gene name
miaB
Definition
(RefSeq) (dimethylallyl)adenosine tRNA methylthiotransferase
  KO
K06168  tRNA-2-methylthio-N6-dimethylallyladenosine synthase [EC:2.8.4.3]
Organism
cbh  Clostridium botulinum A Hall
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbh03016]
    CLC_1743 (miaB)
Enzymes [BR:cbh01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.3  tRNA-2-methylthio-N6-dimethylallyladenosine synthase
     CLC_1743 (miaB)
Transfer RNA biogenesis [BR:cbh03016]
 Prokaryotic Type
  tRNA modification factors
   Methylthiotransferases
    CLC_1743 (miaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM UPF0004 TRAM
Motif
Other DBs
NCBI-GeneID: 5399268
NCBI-ProteinID: YP_001387598
UniProt: A5I2S3
Position
complement(1848665..1850017)
Genome map
AA seq 450 aa AA seqDB search
MNEILNTKDINVIGEFFIETWGCQMNEEDSEKLSGMLKKEGYIRTEERENADVIIFNTCC
VRENAELKVYGNLGILKGLKSKNPNLIIAVTGCMMQQKGMAETIKKKFPFVDIIIGTHNL
HNFPNYLNEVKKKDTSVLKIQEKENSIIENMPIDRKNSMKAFVTIMYGCNNFCTYCIVPY
VRGRERSRTPENIEAEIKKLISEGYKEITLLGQNVNSYGKDLEPNVTFAELLKRVNNIEG
LERVRFMTSHPKDLTDDVIEAIAKCDKLCEQIHLPVQSGSSEILKKMNRHYDREKYLDVV
SKIKKLIPNVALSTDIIVGFPGETEKDFEETLSLVKEVEYDSAFTFLYSIRKGTPAAKFE
DQVPEDVKHKRFNRLVEVLNEISAKKNKAYEGKIEEVLVEGTSKNDENKLMGRTRTGKLV
NFIGDKDSIGELVNVKIIKANSFSLTGEEI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaaatattaaatacaaaagatataaatgttataggtgaatttttcatagaaacc
tggggttgccaaatgaatgaagaggattcagaaaaactttcaggtatgttgaaaaaagag
ggatatataaggactgaagaaagagaaaatgcagatgtaattatattcaacacctgctgt
gttagagaaaatgcagaacttaaagtatatggtaatttagggatacttaaaggtttaaaa
tctaaaaacccaaatttaattatagctgtaactggttgcatgatgcaacaaaaaggtatg
gcagaaaccattaaaaagaaatttccttttgtagatattataataggaactcataatctg
cataacttcccaaattatttaaatgaagttaagaaaaaagatacatctgtattaaagata
caagaaaaagaaaatagcataatagaaaatatgccaatagatagaaaaaatagtatgaaa
gcttttgttactataatgtatggttgcaataatttctgtacttattgtatagttccttat
gtaagaggaagggaaagaagtagaacccctgaaaatatagaagctgaaataaagaaacta
atttcagaaggttataaggaaataactctacttggccaaaatgtaaattcctatggtaag
gatttagaacctaatgttacatttgcagagcttttaaaaagagtaaataatatagaagga
ttagaaagagtaagatttatgacttcccatccaaaggacttaacagatgatgttatagaa
gctattgctaaatgtgataaactgtgtgaacaaatacatcttcctgtacaatccggttct
agtgaaatattgaaaaaaatgaatagacattatgatagagaaaaatatttagatgtagta
tccaaaataaaaaaacttatacctaacgtagcactttctactgatataatagtaggattc
cctggagaaacagaaaaagactttgaagaaacattaagtttagtaaaggaagtggaatac
gactctgcttttaccttcttatattccataagaaagggaaccccagctgctaaatttgag
gatcaagtacctgaagatgttaaacacaagagatttaatagattagtagaagttcttaat
gaaataagtgctaaaaagaacaaagcctatgaaggaaaaatagaagaagttttagtagag
ggtactagtaaaaatgacgaaaataaattaatgggtagaacaagaacaggaaaacttgtt
aactttattggcgataaagactccataggagagcttgttaatgttaaaataataaaagcg
aactctttttcattaacaggggaagagatttaa

DBGET integrated database retrieval system