KEGG   Clostridium botulinum A Hall: CLC_1744Help
Entry
CLC_1744          CDS       T00575                                 

Definition
(RefSeq) aminotransferase, classes I and II
  KO
K05825  2-aminoadipate transaminase [EC:2.6.1.-]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00300  Lysine biosynthesis
cbh01100  Metabolic pathways
cbh01130  Biosynthesis of antibiotics
cbh01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    CLC_1744
Enzymes [BR:cbh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     CLC_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR Beta_elim_lyase Cys_Met_Meta_PP SepSecS
Motif
Other DBs
NCBI-GeneID: 5401710
NCBI-ProteinID: YP_001387599
UniProt: A5I2S4
Position
1850489..1851679
Genome map
AA seq 396 aa AA seqDB search
MNIRFSERAAGLKASEIRELLKLTEMPEIISFAGGLPAPELFPVEEMKGIMQEVLDTQGR
AALQYSSTEGYKPLREIIANERMKPAGVNVSFENIAITNGSQQGIEFSAKIFLNEGDIVV
CESPSYLGAINAFKSYRPKFVEIPMDDNGMIIEELEKALAENKGKVKMIYTIPDFQNPTG
RTMPDDRRKRIAELAAEYEIPVIEDNPYGDLIYEGERHPSIKSFDKEGWVIYLGTFSKNF
CPGLRLAWVCAEPEILDKYIIVKQGVDLQAGTLDQRATALFMQKYDLNEHIEKIKKVYEK
RRDLMLDSMKKYFPADVKYTHPVGGLFTWVELREDLDAKELMKDALAENVAYVPGGSFFP
NGGHENYFRLNYSCMSDEKIVEGVKRLGKVLDKYYK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacgtttttcagaaagagcagcaggattaaaagcatcagagataagagaatta
ttaaaattaaccgaaatgccagaaataatttcttttgcgggaggattaccagcaccagaa
ttattccctgtagaagaaatgaaaggtataatgcaagaagtattagatactcaaggaaga
gcagcattacaatacagctctactgaagggtataaaccattaagagaaatcatagctaat
gaaagaatgaaaccagcaggtgtaaacgtttcttttgaaaatattgctataactaatggt
tcccaacaaggtatagaattttcagctaaaattttcttaaatgaaggagatatagttgtt
tgtgaaagtcctagttatttaggtgctataaatgcatttaaatcttatagacctaaattt
gttgaaatacctatggacgataatggaatgattatagaagaattagaaaaagctttagca
gagaataaaggcaaagttaaaatgatatatacaatccctgatttccaaaatccaactggt
agaactatgccagacgatagaagaaagagaatagcagaattagctgcagaatatgaaata
cctgtaatagaagataatccatatggagatcttatatatgaaggtgaaagacatccatct
ataaagagttttgataaagaaggatgggttatttatcttggaactttctctaaaaacttc
tgtccaggattaagacttgcatgggtttgtgctgaacctgaaatattagataaatatata
attgtaaaacaaggtgttgatttacaggctggtacattagatcaaagagcgacagcttta
tttatgcagaaatatgatttaaatgaacatattgaaaaaattaaaaaagtttatgaaaaa
cgcagagatttaatgctagatagtatgaaaaaatacttcccagcagatgtaaaatatact
catcctgttggaggattatttacatgggttgaattaagagaagatttagatgctaaagaa
ttaatgaaagatgctttagctgaaaatgttgcttatgtacctggtggttctttcttccct
aacggaggacatgaaaattactttagattaaactactcttgtatgagtgatgaaaaaata
gttgaaggtgtaaaaagactaggtaaagttttagataaatattataaataa

DBGET integrated database retrieval system