KEGG   Clostridium botulinum A Hall: CLC_1746Help
Entry
CLC_1746          CDS       T00575                                 

Gene name
aspB-1
Definition
(RefSeq) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00220  Arginine biosynthesis
cbh00250  Alanine, aspartate and glutamate metabolism
cbh00270  Cysteine and methionine metabolism
cbh00330  Arginine and proline metabolism
cbh00350  Tyrosine metabolism
cbh00360  Phenylalanine metabolism
cbh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbh00401  Novobiocin biosynthesis
cbh01100  Metabolic pathways
cbh01110  Biosynthesis of secondary metabolites
cbh01130  Biosynthesis of antibiotics
cbh01210  2-Oxocarboxylic acid metabolism
cbh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLC_1746 (aspB-1)
   00270 Cysteine and methionine metabolism
    CLC_1746 (aspB-1)
   00220 Arginine biosynthesis
    CLC_1746 (aspB-1)
   00330 Arginine and proline metabolism
    CLC_1746 (aspB-1)
   00350 Tyrosine metabolism
    CLC_1746 (aspB-1)
   00360 Phenylalanine metabolism
    CLC_1746 (aspB-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLC_1746 (aspB-1)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    CLC_1746 (aspB-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbh01007]
    CLC_1746 (aspB-1)
Enzymes [BR:cbh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     CLC_1746 (aspB-1)
Amino acid related enzymes [BR:cbh01007]
 Aminotransferase (transaminase)
  Class I
   CLC_1746 (aspB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 Aminotran_MocR OKR_DC_1 Aminotran_3 DUF5564
Motif
Other DBs
NCBI-GeneID: 5400954
NCBI-ProteinID: YP_001387601
UniProt: A5I2S6
Position
1851980..1853170
Genome map
AA seq 396 aa AA seqDB search
MKFSKRISDMQFSPIRKLAPYAAEAKSKGIHVFHLNIGQPDIKTPECFAEGVKSYEEPVL
KYSDSKGMDTLLESFIKYYKQWNTTFDKDELLVTNGGSEAIQFVLMALCDVGDEIIIPEP
FYTNYNGFAESAGVNVVPFLTKAEEGFHLPKKEEIVSKISDKTRAILVSNPGNPTGVVYT
YEELRMLADIAKEHDLFLIADEVYREFVYDGLKYTSAMYLEDVQDRVIIIDSISKRYSAC
GARIGLVASKNRELIHQILKLCQSRLCVPTVEQLGAANLINTPESYFTEVKAEYENRRNI
MFEGLKNIPGVICEKPTGAFYIVAKLPVDNAEEFTKWMLTKFSHNNKTVMVAPAAGFYAT
EGLGEDEIRLSYCLKGEDLKEAMEILKLAIEKYNSK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcaaaaagaatatctgatatgcaattttcaccaataagaaagcttgcacct
tatgcagctgaagctaagagtaaaggtatacatgtttttcatttaaacataggacaacca
gatattaaaactccagaatgctttgctgaaggtgtaaaatcttatgaagaacctgtatta
aaatattcagattctaaaggtatggatactttattagaaagttttataaaatattataaa
caatggaatacaacttttgataaagatgaattattagtaacaaatggtggaagtgaggct
attcaatttgtattaatggctttatgtgatgttggagatgagattataataccagaacca
ttttatacaaactataatggctttgctgaatcagctggagttaatgtagttcctttcttg
acaaaagcagaagaaggattccatcttccaaagaaagaagaaatagtaagcaaaatatct
gataaaacaagagcaatattagtttcaaatccaggaaacccaactggagttgtttatact
tatgaagaattaagaatgcttgcagacattgctaaagagcatgatttattcttaattgca
gatgaagtttatagagaattcgtatatgatggattaaaatatacatcagctatgtatcta
gaagatgtacaagacagagttataataatagatagtatatctaaacgttacagtgcttgt
ggagctagaataggacttgtagcttctaaaaacagagaacttatacatcaaatattaaaa
ttatgtcaatcaagattatgtgttcctacagtagaacaacttggagcagctaacttaata
aatactccagaaagttatttcacagaagtaaaagctgaatatgaaaacagacgtaatata
atgtttgaaggattaaaaaatatacctggagttatatgtgaaaaaccaacaggagctttt
tacatagtagctaaacttcctgtagataatgcagaagaatttactaaatggatgctaact
aagtttagtcacaataataaaactgttatggtagctccagcagctggattctacgcaaca
gaaggtttaggcgaagatgaaataagactttcctattgcttaaaaggtgaagatctaaaa
gaagctatggaaatattaaaattagctatagaaaaatataatagcaaataa

DBGET integrated database retrieval system