KEGG   Clostridium botulinum A Hall: CLC_1750Help
Entry
CLC_1750          CDS       T00575                                 

Gene name
cmk
Definition
(RefSeq) cytidylate kinase
  KO
K00945  CMP/dCMP kinase [EC:2.7.4.25]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00240  Pyrimidine metabolism
cbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CLC_1750 (cmk)
Enzymes [BR:cbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.25  (d)CMP kinase
     CLC_1750 (cmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytidylate_kin Cytidylate_kin2 AAA_18 AAA_17 SKI ADK RuvB_N AAA dNK AAA_22 AAA_14 AAA_33 RNA_helicase AAA_24
Motif
Other DBs
NCBI-GeneID: 5401093
NCBI-ProteinID: YP_001387605
UniProt: A5I2T0
Position
complement(1857435..1858088)
Genome map
AA seq 217 aa AA seqDB search
MLDISIAIDGPAGAGKSTIAKIIGNKLNIMYINTGSMYRAVTLMALKNNIEPYDIESLKA
LINSMNISFNGNNIIVNGKDLEEDIRMPIINNNVSKYAAVEEVRELLVSMQQNISKKYNV
VMDGRDIGTVVLKDAPYKFFITASAEVRAKRRLKELKEKGININFRDVLKEIKERDYIDS
NRKVNPLKQSKDAILIDTSNFTIEEVVDKICTIIKKD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgttggatatatctatagccatagatggccctgcaggagcagggaaaagcaccatagca
aaaattattggaaacaaattaaatataatgtacataaatacaggttctatgtatagggca
gtaacccttatggccttaaaaaataatatagaaccctatgatatagaaagccttaaagct
ttaattaattccatgaatataagttttaatggtaataatataattgttaatggaaaagac
ttagaagaagatataagaatgcctataataaataataatgtatctaaatatgcagcagtt
gaagaagttagggaacttttggtttctatgcaacaaaatataagtaaaaaatataatgta
gtaatggatgggcgagatataggtactgtagttcttaaggatgccccttacaaatttttt
attacagcaagtgcagaagttagggcaaaaagaaggttaaaagaattaaaagaaaaagga
ataaatataaattttcgggatgtactaaaggaaattaaagaaagagattatatagacagc
aatagaaaagttaatcccctaaaacaaagtaaagatgctattttaatagatacttctaat
tttactatagaagaagtagttgataaaatatgtaccataataaaaaaagattaa

DBGET integrated database retrieval system