KEGG   Clostridium botulinum A Hall: CLC_1752Help
Entry
CLC_1752          CDS       T00575                                 

Definition
(RefSeq) pyridine nucleotide-disulfide oxidoreductase
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HI0933_like Pyr_redox_2 FAD_oxidored DAO GIDA Pyr_redox_3 Pyr_redox FAD_binding_2 Trp_halogenase NAD_binding_9 FAD_binding_3 NAD_binding_8 Amino_oxidase Thi4 Lycopene_cycl TrkA_N Amidase_5 AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 5400001
NCBI-ProteinID: YP_001387607
UniProt: A5I2T2
Position
complement(1858535..1859758)
Genome map
AA seq 407 aa AA seqDB search
MSKIIVIGGGPAGMMAAIKAAEKHDVILIERNEKLGKKLYITGKGRCNVTSSKDISEFFD
YIPTNPYFLYSPLYTFTNEDAIKFFNDRNIKLKVERGDRVFPSSDKSSDIIYALEKELIE
RNVKILLNKRITRIYKEDSNIKYVETEKGEKIKGDYFILCTGGVSYPQTGSEGDGHKIAK
KLGHNIKELKPSLVPLETKEEWVKDLQGLALKNVEIKIIDSKNKTLYKNFGEMLFTHFGI
SGPIVLTASSVIDRDNLKVFINLKPALSSNDLDERIQKDFKKYCNRDFSNSINDLLPKKL
IDIIINLSKIDPNKKVNSITKEERKSLVYLLQNLPLTVKGKRPIKEAIVTSGGVDVLNID
PSTMKSKIVNNLYFAGELIDVDAFTGGFNIQIALSTGYLAGLKVGEN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaaattatagtaataggcggtggccctgctggtatgatggcagcaattaaagca
gcagaaaaacatgatgttatattaatagaaagaaatgaaaagctaggcaaaaaattatat
ataactggaaaaggtagatgtaacgtaacaagttctaaagatataagtgaattttttgat
tatattccaactaatccttattttttatatagtcctttatatactttcaccaatgaagat
gctattaaattttttaatgatagaaatattaaattaaaagtagaaagaggagatagagta
tttccttcttcagataaatcttcagatataatatatgctttagaaaaagaacttatagaa
agaaatgtaaagatattacttaataaaagaataacaagaatttataaagaagattcaaac
ataaagtatgtggaaacagaaaaaggagaaaagataaagggagattattttatattatgt
accggaggagtatcctatcctcaaacaggctccgaaggtgatggacataaaatagcaaaa
aaattaggccataatataaaagaattaaaaccatctttagttcccctagaaacaaaagaa
gaatgggtaaaagacttacaaggactggcattaaaaaatgtagaaataaaaattatagac
tctaaaaataaaacattatataaaaattttggagaaatgctatttactcattttggcata
tctggtcctattgtgctcacagctagtagtgtaatagatagagataatttaaaagtcttc
ataaatttaaaacctgctctttcatctaatgatttagatgaaagaatacaaaaagatttt
aaaaaatattgcaatagggattttagtaactctataaatgatttattacctaaaaaactt
atagatattataataaacttaagtaaaatagatccaaataaaaaagtaaactccattaca
aaagaagaaagaaaaagtttagtgtatctattacaaaatttaccgttaaccgtaaaaggt
aaaaggcctataaaagaagctatagtaacctctggaggtgttgatgtgctaaatatagac
ccatctactatgaaatctaaaatagtaaataatttatattttgcaggagagttaatagac
gtagatgcttttactggtggatttaatatacaaatagctctatctacaggttatttggct
ggtttaaaggtaggtgaaaattga

DBGET integrated database retrieval system