KEGG   Clostridium botulinum A Hall: CLC_1754Help
Entry
CLC_1754          CDS       T00575                                 

Definition
(RefSeq) RpiR family transcriptional regulator
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS HTH_6 DUF4364 TMPIT HTH_36 SIS_2
Motif
Other DBs
NCBI-GeneID: 5401550
NCBI-ProteinID: YP_001387609
UniProt: A5I2T4
Position
complement(1861553..1862437)
Genome map
AA seq 294 aa AA seqDB search
MEENKQDLMRIIQVKFPRLSKGQKLIAEFILKHYDKAAFMTAAKLGTSVGVSESTVVRFA
NELGFTGYPKLQKALQELIKNKLTTVQRIELSNDYVSEESALKGVLKSDMENIRATLEKI
NHNTFQDVVDNIFEAKRIYIMGLRSSTALAEFLGFYLNLILDNVNIIAYGISDIFEQMIN
VSENDLVIGIGFPRYAARTIEALTFAQNRGAKVVAITDSLLSPLAAKADYTLIAQSNMAS
FVDSLVAPLSVINALIIAVGLREKEKISSTFSTLEGIWQEYEVYSYRDNKDKKY
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaacaaacaagatttaatgagaataattcaagttaaatttccaagattaagt
aaagggcaaaaattaatagcagaatttatattaaaacattatgataaagctgcttttatg
actgcggcaaaacttggaacaagcgtaggtgttagtgagtctactgtagttagatttgca
aatgagcttggatttactggatatccaaaacttcaaaaggctctacaagaacttataaaa
aataaacttacaacagttcaaagaatagaactttcaaatgattatgtaagtgaagagtct
gctttaaagggtgtactaaaatctgatatggaaaatataagagctactttagaaaaaatt
aatcataatacttttcaagatgtagtggataatatatttgaagctaaaagaatttatatt
atgggacttagaagttctactgctttagcagagtttttaggattctatttaaatttaata
ttagataatgtaaatataattgcttatggaattagtgatatttttgaacaaatgataaat
gtatcagaaaatgacttagttataggtataggttttccaagatacgcagctagaaccata
gaagcactaacttttgctcaaaatagaggagcaaaggttgtagctataacagatagttta
ttatctcctttagctgcgaaggcagattatacattaatagcccaaagtaatatggcttcc
tttgtagattctttggttgctcctcttagtgtaataaatgcattaattatagcagtaggt
ttaagagaaaaagaaaaaatatcttcaacctttagtactcttgaaggtatttggcaagaa
tatgaagtttattcttacagggataataaagataaaaagtactaa

DBGET integrated database retrieval system