KEGG   Clostridium botulinum A Hall: CLC_1760Help
Entry
CLC_1760          CDS       T00575                                 

Definition
(RefSeq) methyl-accepting chemotaxis protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal sCache_3_2 HAMP sCache_3_3 IncA Nsp1_C
Motif
Other DBs
NCBI-GeneID: 5400933
NCBI-ProteinID: YP_001387615
UniProt: A5I2U0
Position
1869277..1871298
Genome map
AA seq 673 aa AA seqDB search
MFTKENLKKLSFKKKIVITSLLIFLISMSLLTGFTFKMVSSKFKNQVREDGLNLANQVSY
QITSSQKATKEIDKVLADKVLSISKMVIENKNISNEYLTSVAVKCNIQEINITDKNGKII
YSNMPENINYVYPLDYSGQDILKGKKDEIIEEIRQNKVNHNYYKYCALAMPNGGLIQTGI
NANEIHNINKSVDPQIILEKLTKDSNIKFALVMDNKLKVTHHSDKKRIGKILTDTGSKTA
IDTGKNYTSTYDYEGEKVYDIIMPLKDESGKLLGSMDIGVSLATQETALRNILITSILIS
LITFVLAGLVILYIIKLSLKPLDNLSSIAQKVSKGDLTEKVEIVNEDEIGKLSKIFNTMI
DSLREITRNINNFSIQLAGSSQEILSSAEQTSAVSEEISSATEEIASGAENQVKASNESS
LLMNDVMGNMYTLKEEFDEIISFSNNTNTLASKGQENMSNMVQQMATIKNSVVNSSNIMY
DLQKNSEEIGNIVEIINTIADQTNLLALNASIEAARAGEAGKGFAVVADEVRKLAEESIN
SANNIKNLIMNTQDKTKTALNSIKDGASQSEKGESIVAEVKESLGEILNSFSNVNHKFAS
VDSMITASNDSITAMASKLYDIETISNTASANTEEVAASTEEQSATIEEITESIEKLVSM
VENLKESVSIFKL
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgtttactaaagaaaatcttaagaaacttagttttaaaaagaagatagtaataacttct
ctattgatttttttaatttcaatgagtttattaacgggttttacttttaaaatggtaagt
agtaaattcaaaaatcaagttagagaagatgggttaaacttagcaaatcaagtaagctat
caaattacttcatctcaaaaagctacaaaggagatagataaagttttagcagacaaagtt
ttatccatttcaaagatggttatagaaaacaaaaatatttctaatgaatatttaaccagt
gttgcagtaaaatgtaatatacaagaaataaatataacagataaaaatgggaaaataata
tattcaaatatgccagaaaatataaactatgtatatcccttggattattctggacaagat
atattaaagggtaaaaaagatgaaattattgaagaaataagacaaaataaagtaaatcat
aattattataagtattgtgcattagctatgcctaatggtggtctaatacaaacaggtatt
aatgcaaatgaaatccacaatattaataaatctgtagatccacaaattatattagaaaaa
ttaacaaaagatagtaatataaaatttgctttagttatggataataaacttaaagttacc
caccatagtgataaaaaaaggataggaaaaattttaactgatactggaagtaaaactgca
atagatactgggaagaattatacatctacatatgattatgaaggtgaaaaagtttatgat
attataatgcctttaaaagatgaaagtggtaaactattaggatctatggatataggagta
tctttagctactcaagaaaccgctcttagaaatatattaataacttctatattgataagc
ttaataacttttgttttagctggattagtaatactttatataataaaactatctttaaaa
ccactagataatttgtctagtatagctcaaaaggtttcaaagggtgatttaacagaaaag
gttgaaattgttaatgaagatgaaattggaaagctaagcaaaatatttaatactatgata
gatagtttaagagaaattacacgaaatataaataatttttcaatacagttagctggttcc
tctcaggaaattttatcctctgcagagcaaacttcagcagtatcagaggaaatttctagt
gctactgaagaaattgcttcgggagctgaaaatcaagtgaaggctagtaatgaatcttcc
ctattaatgaatgatgttatgggaaatatgtatactttaaaagaggagtttgatgaaata
atatctttttctaataatacgaatacattagcttcaaagggacaagaaaacatgtctaat
atggtacagcaaatggctacaataaaaaatagtgtggtaaattcatctaatataatgtat
gatttacaaaagaattcagaggaaataggaaatattgtagaaattataaatactatagca
gatcaaactaatttattagcattaaatgcctccattgaagctgctagagcaggagaagct
ggaaaaggttttgcagtagtagcagatgaagttagaaaacttgcggaagaatctataaat
tctgctaataatattaagaatttaataatgaatactcaagataaaactaagactgcttta
aattctataaaggatggtgcttcacaatctgaaaaaggtgaaagcatagttgctgaggta
aaagaatctttaggagaaattttaaattcattttctaatgtgaaccataagtttgcaagt
gtagattctatgattacagcttccaatgatagtattacagctatggcatcaaaattatat
gatatagaaaccatatctaatacagcctccgctaatacagaagaggtagctgcttctaca
gaagaacagagcgctaccatagaagaaattactgaatctatagagaagttagttagtatg
gtagaaaatttaaaggaaagtgtatctatatttaaactttaa

DBGET integrated database retrieval system