KEGG   Clostridium botulinum A Hall: CLC_1761Help
Entry
CLC_1761          CDS       T00575                                 

Definition
(RefSeq) cytochrome c-type biogenesis protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbD DsbD_2 MerE
Motif
Other DBs
NCBI-GeneID: 5400599
NCBI-ProteinID: YP_001387616
UniProt: A5I2U1
Position
complement(1871342..1872028)
Genome map
AA seq 228 aa AA seqDB search
MNEIITKAVSLMGNNVLLALLISFLGGIISSFSPCILSSLPLIIGYVNKYGRDDKKTAFK
YSLFFSLGIIITFTSLGIISSLVGKFFTSGGKLWYLLLGVVMIFVGLQLIGVIESKNKAC
KVPKKRKGLLGAFFLGILGGVLSSPCSTPILIAILAFVGSKGNILLGFLMLLLYSIGHCF
VIILSGTSLGFVESLSGSSKANKINNVLKIILGIIILAMGLYLIYIGI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagattataacaaaagctgtaagcctaatgggaaataatgttcttttagccttg
ttaatatccttcttaggaggtataatttcttcctttagtccttgtatactttcatcactt
cctttaataataggttatgtaaataaatatggtagagatgacaaaaaaaccgcttttaaa
tattctttattcttttctttaggtataataattacatttacttccttaggtataatttct
tctttagtagggaaattttttacttctggtggtaagctatggtatttattattaggagtt
gtaatgatttttgtaggattacaacttataggggtaatagaatctaaaaataaggcatgt
aaagtgcctaaaaagcgaaagggactacttggtgcattttttttaggaatattaggtgga
gttttatcctcaccttgttctacacctatattaatagctatactagcttttgtaggaagt
aaaggtaatatattattaggatttttaatgttacttttatactctataggtcattgtttt
gtaataatcttatcaggaacttcactgggttttgttgaatctttaagtggatcttctaaa
gcgaacaaaataaataatgtattaaaaataatattaggaataattatattagctatgggg
ctttatctaatatatataggaatataa

DBGET integrated database retrieval system