KEGG   Clostridium botulinum A Hall: CLC_1764Help
Entry
CLC_1764          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF986 DUF4389 PIG-F
Motif
Other DBs
NCBI-GeneID: 5398535
NCBI-ProteinID: YP_001387619
UniProt: A5I2U4
Position
complement(1873543..1874097)
Genome map
AA seq 184 aa AA seqDB search
MKFEKILQIVLVIAIVIQFFYSFILGRKQDKNIGNKLMTLKRSAMKQSSILLLMICIVFY
MLYAFVKGTASNTGLLIIIYFLISIYDFTKLKIVTDKGIGNKSLYNNSIYNFVYWEDITR
WEWHPKHPNLLFFTFSNKKGNADRRDWDIPSSDKENFESILNKYVKHAFVDSTLENMKRN
SEKK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatttgaaaaaatattgcaaatagttttggtaatagctatagttattcagtttttt
tattcttttatattaggacgaaaacaagataaaaatattggtaataaattaatgacctta
aaaagaagtgcaatgaaacaaagttctatattattgcttatgatatgcattgtattttat
atgctatatgcttttgtaaaggggactgcttctaatacagggttacttataatcatatat
tttctaataagtatatatgatttcaccaaattaaaaatagtaacagataaaggtattgga
aataaaagtttatataacaatagtatatataattttgtatactgggaagatataacaaga
tgggaatggcatcctaaacatcctaatcttttattttttactttttcaaacaaaaaagga
aatgcagatagaagagattgggatattccatcttcagataaagaaaattttgaatccata
ctaaataaatatgtaaagcatgcttttgtagatagcactttagaaaatatgaaacgtaat
tctgaaaaaaagtaa

DBGET integrated database retrieval system