KEGG   Clostridium botulinum A Hall: CLC_1766Help
Entry
CLC_1766          CDS       T00575                                 

Gene name
pcaC-1
Definition
(RefSeq) 4-carboxymuconolactone decarboxylase
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD DUF5371
Motif
Other DBs
NCBI-GeneID: 5400564
NCBI-ProteinID: YP_001387621
UniProt: A5I2U7
Position
complement(1876067..1876411)
Genome map
AA seq 114 aa AA seqDB search
MSESPKQMIEHLQKGAGKLASSSPQEMKALTDFVQSVFKEGALDLKTKEAIAIAISVYSR
CPYCISAHVKNALATGLTREQIIEAGTVAMAFGGGPAMAYSSTVLIDALNELEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaagtccaaaacaaatgatagaacatttacaaaaaggggcagggaaattagca
tcctctagtccacaagaaatgaaagctttaactgattttgtacaatcagtttttaaggaa
ggtgccttagatttaaaaaccaaggaagctattgctatagctatatctgtttatagtaga
tgcccttactgcatatcagctcatgttaaaaatgctttagctacggggttaactagagaa
caaataatagaagctgggacagtagcaatggctttcggtggtggtccagcaatggcttat
agttctacagtattaattgatgctttaaatgaattagaaaaataa

DBGET integrated database retrieval system