KEGG   Clostridium botulinum A Hall: CLC_1770Help
Entry
CLC_1770          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chordopox_A13L PrgI DUF2207 DUF1517 EMP70 DUF5090 TMEMspv1-c74-12
Motif
Other DBs
NCBI-GeneID: 5401661
NCBI-ProteinID: YP_001387625
UniProt: A5I2V1
Position
complement(1878267..1878500)
Genome map
AA seq 77 aa AA seqDB search
MGKYISTIIITIIFSIIILLYGSAFLIPIFGIGNSMAKLLLSIIVLPFIALVGALIYNMY
ERIKEIKEEDKDDISKY
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaatatattagcactataattataactataatattttcaattataatactatta
tatggtagtgcttttttaatacctatatttggtataggcaacagtatggctaaactttta
ttaagtattatagttttacctttcatagctttagttggagcattaatatacaatatgtat
gaaagaattaaagaaatcaaggaggaagataaggatgatattagtaaatactga

DBGET integrated database retrieval system