KEGG   Clostridium botulinum A Hall: CLC_1771Help
Entry
CLC_1771          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2Fe-2S_thioredx DUF1636
Motif
Other DBs
NCBI-GeneID: 5401716
NCBI-ProteinID: YP_001387626
UniProt: A5I2V2
Position
1878634..1878876
Genome map
AA seq 80 aa AA seqDB search
MLIINICVGSACHLKGSYKVITLLQNFIGKNNLKDKVEIKGSFCLGYCTEGVSVKIQDKI
YSVNEENVEEFFNNVVLRGI
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgttaataataaatatttgtgtgggaagtgcctgtcatttaaaaggttcttataaagtt
ataactttactccaaaattttatagggaaaaacaatttaaaagataaagtagaaataaag
ggttctttttgtttaggttattgtactgagggtgtttctgtgaaaattcaagataaaatt
tattctgtaaatgaagaaaatgtagaagagttttttaataatgtggtattgaggggtata
tag

DBGET integrated database retrieval system