KEGG   Clostridium botulinum A Hall: CLC_1772Help
Entry
CLC_1772          CDS       T00575                                 

Definition
(RefSeq) sensory box-containing [Fe] hydrogenase
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe_hyd_lg_C Fer4 Fer4_6 FeS Fer4_7 Fer4_21 Fer4_10 Fer4_16 Fer4_9 PAS Fer4_2 PAS_9 Fer4_15 Fer4_8 Fer4_4 Fer4_13 PAS_8 PAS_4 Fer4_3 zf-H2C2_2
Motif
Other DBs
NCBI-GeneID: 5400187
NCBI-ProteinID: YP_001387627
UniProt: A5I2V3
Position
1878879..1880603
Genome map
AA seq 574 aa AA seqDB search
MNYIDISGLNCKNCYKCLRACPVKAIKFKNEKAEIVEERCISCGRCLVICPQNAKKDKPD
IKYVKDAIRSRKKIVASVSSVFAGVFNVEEGKIVSALRELGFSYVEETALGGEIVTELYK
DYVERTKLNNYITTSCPSTVNLIEKYFPSLIKYMIPIASSMAAHGKILKEIWGKDAFVVF
IGPCIAKKTESDSYKKEKIVDAVINFDELKTLFKECNIDLNSMPVGEFDRNAYKKTRSFT
LSGGIINSMGNVIENNNLIAMSVSGIEESIQVLKSMEIGEISNAFLEITACRGNCVGGPN
MIKNEVSYYTRLSKVKNYIKNRDTSNTIRLLSVPDSIDFSTSFKDIHFEKKKAPRKELLK
IMKSMGKHTKEDELNCGVCGYNTCIEKAQAIYEGMAETNMCLHFMRNKAENLTNVIFENT
VNCIFILDENMNVKEINPAAEEVFMIKAKDIKDKPISLLINDADFRYVRETGKSIIGKKV
YYYKYNVIFIKTIVYMPKQDIVMVSMMDITKEEENKEELLKVKEQTIDTAQKVIEKQMRV
AQEIASLLGETTAETKITLTKLKQVVEGDKSDIK
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaattatatagatatatctggtttaaactgcaaaaattgttataaatgtttaagggct
tgcccagtaaaagctattaaatttaaaaatgaaaaagctgaaatagttgaagaaagatgt
atatcatgtggaagatgtcttgtgatttgtcctcaaaatgctaaaaaggataaaccagat
ataaaatatgtaaaagatgctataagatctaggaaaaaaattgtggctagtgtttcctca
gtatttgcaggagtatttaatgtggaggaaggtaagatagtttctgctttaagagaatta
ggattttcttatgtagaggaaacagcccttggtggagaaattgtcaccgagctctataag
gattatgtagaaagaactaaattaaacaattatattaccacctcttgcccttctactgta
aatttaatagaaaagtattttcctagtcttataaaatatatgattcctattgcttcttcc
atggcagctcatggaaaaatattaaaggaaatttggggtaaagatgcctttgtagtattt
ataggcccttgtatagctaaaaagacagaatcggatagttataaaaaagaaaaaattgta
gatgctgttataaattttgatgagctgaagactttgtttaaggagtgtaatatagactta
aattctatgcctgtaggagaatttgatagaaatgcctacaaaaaaactcgctcttttact
ttaagtggtggaataataaattctatggggaatgtaatagaaaataataacttaatcgct
atgtcagtaagtgggattgaagaatctattcaagtattaaaaagtatggaaataggtgaa
atatctaatgcctttttagaaattactgcctgtagaggtaattgtgtaggaggacctaac
atgattaaaaatgaagtttcttactatacaagattaagtaaagttaaaaattatataaaa
aatagagatactagtaatacaataagattactttctgtaccggatagtattgatttttca
acatcttttaaagatatacattttgaaaagaaaaaggctccaagaaaagaacttttaaag
ataatgaaaagtatgggtaaacatacaaaggaagatgaacttaattgtggagtatgcggc
tataacacttgtatagaaaaagcccaagctatttatgagggtatggcagaaactaatatg
tgtcttcattttatgagaaataaagcagaaaatttaactaatgtaatttttgaaaataca
gttaattgcatctttattttagatgagaatatgaatgtaaaagaaataaatcctgctgct
gaagaagtttttatgataaaagctaaagatataaaggacaagcctatatccctgttaatt
aatgatgcagattttagatatgttagagaaacaggaaaaagtattataggtaaaaaggta
tactattataaatacaatgtaatttttattaaaactatagtttatatgccaaaacaagat
atagttatggtatctatgatggatattacaaaagaagaagaaaataaagaagaactatta
aaagtaaaagaacaaaccatagatacagctcaaaaagtaatagaaaagcaaatgagagta
gctcaagaaatagctagtcttcttggtgaaactactgcagaaacgaagattactttaact
aaattaaaacaagtagtggaaggagataaaagtgatataaaatga

DBGET integrated database retrieval system