KEGG   Clostridium botulinum A Hall: CLC_1775Help
Entry
CLC_1775          CDS       T00575                                 

Gene name
hypE
Definition
(RefSeq) hydrogenase expression/formation protein HypE
  KO
K04655  hydrogenase expression/formation protein HypE
Organism
cbh  Clostridium botulinum A Hall
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    CLC_1775 (hypE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 5401003
NCBI-ProteinID: YP_001387630
UniProt: A5I2V6
Position
complement(1883996..1885000)
Genome map
AA seq 334 aa AA seqDB search
MNGFITLSHGHGGKYTHDLIEKLMYKYFNNKTLIEGIDSATFNIKKGKLAFTTDSFVVKP
LFFNGGDIGKLAICGTVNDLSVSGAKPLYLSCSFIIEEGFPIEKLEIIVKSMASTAKEAN
VLIVTGDTKVVEKGSVDQIFINTSGIGIIEDQYSIKNIEKGDKVIVTGNIGDHGTTIALD
RYNLNIKGNLKSDCTPVNTITNKLKEYYPYIKIMKDPTRGGVATTLNEISSLSKNLGICV
WEDKIPIKNEVKAINEMLGLDPLYMACEGRIVMVVKDQYAKDILKIIKKIDNCKNAEIIG
TFVKNSYNIVYVENFLGGTRIINMLEGDMLPRIC
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaatggatttattacattaagtcatgggcatggaggcaaatatactcatgatcttata
gaaaagcttatgtataaatattttaataataaaactctcatagaaggtatagattctgca
acttttaatataaaaaaaggaaagttagcctttactacagattcctttgtagtaaaaccc
ttatttttcaatgggggagatataggaaagttggctatatgtggtactgtgaatgattta
tctgtatctggagctaaacctctttatttaagttgttcatttataatagaagagggattt
cctatagaaaaattagagattatagtaaagtctatggcaagcactgctaaagaagctaac
gttttaatagtaacaggagatactaaagtagtagaaaaaggatctgtagatcaaattttt
ataaatacttcaggcataggaattatagaggatcaatattctattaaaaatattgaaaaa
ggtgacaaagttatagttacaggaaacataggggatcatggaacaactatagctttagat
aggtataatttaaacataaaaggaaatttaaaaagcgattgtacaccagtaaatactata
actaacaaattaaaagaatattatccttatataaaaataatgaaagatcctactagagga
ggagttgctacaactttaaatgaaatatcatcactaagtaaaaatttaggtatatgtgtt
tgggaagataaaatacctataaaaaatgaagttaaagcaataaatgaaatgttaggtcta
gatcctttatacatggcctgtgaaggaagaatagttatggtggtaaaagatcaatatgca
aaggatatactaaaaatcataaaaaaaatagataattgtaaaaatgcagaaataataggt
acttttgtgaaaaattcatacaatatagtatatgtagaaaattttttaggtggcacacga
ataataaatatgttagaaggagatatgcttccaagaatatgttaa

DBGET integrated database retrieval system