KEGG   Clostridium botulinum A Hall: CLC_1776Help
Entry
CLC_1776          CDS       T00575                                 

Gene name
hypD
Definition
(RefSeq) hydrogenase expression/formation protein HypD
  KO
K04654  hydrogenase expression/formation protein HypD
Organism
cbh  Clostridium botulinum A Hall
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    CLC_1776 (hypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HypD
Motif
Other DBs
NCBI-GeneID: 5399257
NCBI-ProteinID: YP_001387631
UniProt: A5I2V7
Position
complement(1885168..1886241)
Genome map
AA seq 357 aa AA seqDB search
MANCKLIIEVMDKIKAIDTSPLKIMEVCGSHTEVIGRLGLRDILYPKVNLVSGPGCPVCV
TDESYIDAALKLLNRENILITTFGDLMKVKGTTNSLMDEKPNHNNIKVIYSPLEALKIAK
ENKSLEVIFLAVGFETTIPLIALSIKQAKNEKIKNISFLLGLKTMKPILEHIFKDKNHNI
DGVICPGHVASVKGANYFRFIRDAYNIPAVISGFEPLDILSSIYFIINSNIKNKKTFINL
YKTCVKEDGNKIANELIDEVFCQNDSNWRGIGLIKNSGLDLKNIYSDYDALKKFNVKIEK
HEKSTRCICGEVILGKKSPKECDLFSKECNPGHSKGPCMVSKEGACSIFYRYNKFKL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggctaattgcaaattaataattgaagttatggataagataaaagctatagatacaagt
cctttgaagataatggaagtgtgtggtagccatactgaagttataggtagattaggcttg
agagatattttatatcctaaagtaaatttagtatctggtcccggttgccctgtatgcgta
acagatgaaagctatatagatgcagccttaaagcttttaaatagggaaaatatattaata
accacttttggtgatttaatgaaagttaaaggtactactaatagtttaatggatgaaaaa
ccaaatcacaataatataaaagttatatactcgccattagaggcgcttaagatagcaaaa
gaaaataaatctttagaggttatttttctagcagttggttttgaaactactatcccttta
atagccttatctataaagcaagctaaaaatgaaaagataaaaaatataagttttctacta
ggtttaaaaacaatgaaacccatattagaacatatatttaaagataaaaatcataatata
gatggggtaatttgtccaggccatgtagcttctgttaagggcgctaattattttagattt
ataagggatgcatataatattcctgcagtaatatcaggatttgaacccttagatatctta
agctctatatattttattataaatagtaatataaaaaataaaaaaacttttataaattta
tataaaacctgtgtaaaagaagatggaaataaaattgctaatgagcttatagatgaggtt
ttttgccaaaatgattcaaattggagaggtataggattgattaaaaactctggattagat
ctaaaaaatatatatagtgactatgatgctttaaaaaaattcaatgtgaaaattgaaaag
catgaaaaatccactagatgtatatgcggtgaagttatattaggtaaaaagtctcctaaa
gaatgtgacctgttttctaaagaatgtaatccaggccattcaaagggcccttgtatggta
tctaaagaaggggcttgttctatattttatagatacaataaatttaagctctaa

DBGET integrated database retrieval system