KEGG   Clostridium botulinum A Hall: CLC_1777Help
Entry
CLC_1777          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
  KO
K04653  hydrogenase expression/formation protein HypC
Organism
cbh  Clostridium botulinum A Hall
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    CLC_1777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HupF_HypC
Motif
Other DBs
NCBI-GeneID: 5399232
NCBI-ProteinID: YP_001387632
Position
complement(1886234..1886461)
Genome map
AA seq 75 aa AA seqDB search
MCIAIPGKIVSIDGYYAITNTMGIESEINISLIENPSINDYVLIHAGCAIEKIDYEYFSY
LKQIIKEALRSNKDG
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgtgcattgcaataccggggaaaattgtaagtattgatggctactatgctataacaaat
actatgggtatagaaagtgaaataaatatatcacttatagaaaatccatctatcaatgac
tatgttctaattcatgcaggttgtgctatagaaaaaatagactatgagtatttttcttac
ttaaaacaaatcataaaagaagccttaaggagtaataaagatggctaa

DBGET integrated database retrieval system