KEGG   Clostridium botulinum A Hall: CLC_1781Help
Entry
CLC_1781          CDS       T00575                                 

Definition
(RefSeq) hydrogenase maturation protease
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HycI
Motif
Other DBs
NCBI-GeneID: 5398717
NCBI-ProteinID: YP_001387636
UniProt: A5I2W2
Position
complement(1890036..1890452)
Genome map
AA seq 138 aa AA seqDB search
MGDDGIAIKIAKNIEGFLKENHIDLIIGETDFEYCLSRIKKEDFLFILDAGYYGKKIGDI
TILPLDTYTSHKNGYTQHSYSFIDLVKLYYNEIKGYILAIEVSNIDYTLKISKELKVNMN
KISDELISIIRKKGKYFK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgatggtatagccataaaaatagctaaaaatattgagggatttttgaaagaa
aatcatatagatcttataataggagaaacggattttgaatattgcctttcaagaataaaa
aaggaggatttcttatttatattagatgcgggatactatggtaaaaaaataggagatata
acaatattacctctagatacttatacatcacataaaaatggatatacccaacatagctat
agttttatagacttagttaaactttattataatgaaataaagggatacattctagctatt
gaagtttctaatatagattacactttgaaaatcagtaaagagcttaaagttaatatgaat
aaaatttctgatgaactaatatctataattagaaagaaaggaaaatattttaaataa

DBGET integrated database retrieval system