KEGG   Clostridium botulinum A Hall: CLC_1784Help
Entry
CLC_1784          CDS       T00575                                 

Definition
(RefSeq) TraX family protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraX
Motif
Other DBs
NCBI-GeneID: 5401140
NCBI-ProteinID: YP_001387639
UniProt: A5I2W5
Position
1893142..1893843
Genome map
AA seq 233 aa AA seqDB search
MELDSFKLKIIAMILMVLDHLPKAFNNTPIWFGWLGRLVAPIFFFFVAEGFFHTKSKSKY
LIRLFGWGAIMFLGSSILNYALPGKEPLQNNIFLSLGLSVLLMCIIDYTRKSKNYKSGIP
LAIVVDILALFTEASFDGVLMTLVFYFFREDKIKLSIGYILISLFEFIMVSGGGLTYLNL
FVLNYQWLMIFALPIILMYNGKRGLNNKFIKYMFYAFYPVHLWIITVISHFLK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggaattagatagctttaaattaaaaattatagcaatgatacttatggtgttagatcat
ttgcctaaagcttttaataacactccaatatggtttggatggcttggtaggttggtagct
cctatatttttcttttttgtggcagaaggattttttcacacaaagagtaagagtaaatat
ttaataaggttatttggatggggcgcaatcatgtttttaggatcatcaatattaaattat
gctctaccaggaaaggagcctttacaaaataatatatttttatccttaggattatcagta
cttttgatgtgtattattgattatactagaaaaagtaaaaattataagagtggtatccca
ctagctattgtagtagatatattagctttatttacagaagcatcttttgatggagtatta
atgactttagttttctacttctttagagaggataaaattaaattatctattggatatatt
ttaatttctttgtttgagttcattatggttagtggtggaggtttaacttatttgaattta
ttcgtattaaattaccaatggttaatgatttttgcccttcccattattcttatgtataat
ggcaaaagaggactaaacaataaatttataaaatatatgttttatgctttttatcctgta
catttatggataattactgtaatatctcactttttaaaataa

DBGET integrated database retrieval system