KEGG   Clostridium botulinum A Hall: CLC_1785Help
Entry
CLC_1785          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2207
Motif
Other DBs
NCBI-GeneID: 5399710
NCBI-ProteinID: YP_001387640
UniProt: A5I2W6
Position
complement(1894005..1894292)
Genome map
AA seq 95 aa AA seqDB search
MIFLRAEKGTEKIYTDIDTLAIRENKFSYSIKKDMFTLIIIMLLFIILRIILDSFINIKI
LNFTVEIIIAGLIGFTVALFIGYLKIKLKPNKYRK
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgatatttttaagagcagaaaaaggaactgaaaaaatatacacagatatagatacttta
gcaataagagaaaataaatttagctatagtattaaaaaagatatgtttacgctaataata
attatgttattatttattatattacgaataattttagactcatttataaatataaaaatc
cttaatttcactgtagaaataataattgcaggattaataggatttacagttgctttattt
attggctatttaaagattaaattaaaacctaataagtatagaaaataa

DBGET integrated database retrieval system