KEGG   Clostridium botulinum A Hall: CLC_1787Help
Entry
CLC_1787          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5401283
NCBI-ProteinID: YP_001387642
Position
1894827..1894994
Genome map
AA seq 55 aa AA seqDB search
MDMLELLIKGVFVVCIITLILRHNLFISTIKIKVRFLGLDIEVDSKEKKHPSSKD
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
ttggatatgctagaacttttaataaaaggagtttttgtggtttgtattattactttaata
ttaagacacaatctttttatttccactataaaaattaaggttagatttcttggtttagat
atagaagttgatagcaaagagaaaaagcacccatcctccaaagattag

DBGET integrated database retrieval system