KEGG   Clostridium botulinum A Hall: CLC_1789Help
Entry
CLC_1789          CDS       T00575                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N AAA_29 RsgA_GTPase MMR_HSR1 NACHT AAA_28 RNA_helicase MukB AAA_33 TrwB_AAD_bind AAA_23 Roc TsaE ATP-synt_ab Septin Dynamin_N AAA_16 AAA_25 NB-ARC MobB SRP54 AAA_24 CAMSAP_CC1 A1_Propeptide DUF87
Motif
Other DBs
NCBI-GeneID: 5399763
NCBI-ProteinID: YP_001387644
UniProt: A5I2W9
Position
complement(1896661..1898217)
Genome map
AA seq 518 aa AA seqDB search
MSILTVKDISHGFGDRAIFEEVSFRLLKGEHVGLIGANGEGKSTFMNIITGKLMPDEGKI
QWAKDVRVGYMDQHLNLTKGKTIREVLREAFDYLFNLEKEMNDLYTKMGEVSQEEMEKML
NRTATIQDMLDHNDFYIIDAKIEEIARGLGIADIGLDKDVSDLSGGQRTKILLAKLLLEN
PDILLLDEPTNYLDEDHIDWLKNYLKNYENAFILISHDIPFLNEVINLIYHVENKRLTRY
VGDYNEFRRVYEENKKRLEAAYERQQAEISKLEDFIAKNKARVSTVGMARSRQKKLDKID
KIELTKEKPKPEFNFKQARASGKVIFETKDLVIGYDSPLTKPLNIKMERGQKVALVGANG
LGKTTLLKSLLGAIKPLEGDVTLGDYQYIGYFEQEERESNYNTCIEEVWKEFPVFTQYEI
RSALAKCGLTTKQLESKIVVLSGGEAAKVRLCKILNRETNILILDEPTNHLDVEAKEELK
RALREYKGSILLVCHEKEFYEDIVTETWNCESWTTKIV
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagtatattaaccgttaaggatattagccatggatttggagacagagctatttttgag
gaagtatcctttagacttttaaagggagagcatgtaggacttattggagctaatggagag
ggtaagtctacatttatgaatataataacaggaaaactaatgccagatgaggggaaaatt
caatgggcaaaggatgtaagagtaggctacatggatcagcatttaaatcttacaaaggga
aaaaccattagagaagttttgagggaagcctttgactatttatttaatcttgaaaaagaa
atgaatgatttatacacgaaaatgggagaggtatcccaggaagaaatggaaaaaatgcta
aatagaacagctactatacaggatatgttagatcataatgatttttacataatagatgct
aaaatagaggaaatagcaaggggacttggtattgctgacataggtttggataaggatgta
tcagatttatctggaggacaaagaacaaaaatacttctagcaaaactccttttagaaaat
ccagatatattacttttagatgagcctacaaactatttagacgaagatcacatagattgg
cttaaaaattatcttaaaaactacgaaaatgcctttatattaatatcccatgatatacca
tttttaaatgaggtaataaatttaatttatcatgtagaaaataaaagacttactcggtac
gtaggggattataatgaatttagaagagtttatgaggaaaataagaaacgactagaggcg
gcctatgaaaggcaacaggcagaaatatcaaaactagaagattttatagccaaaaataaa
gcaagagtttccaccgtaggtatggcaagatctagacaaaaaaaattagataaaatagat
aaaatagaacttacaaaagaaaaaccaaagccagaatttaattttaaacaggctagagct
tctggaaaagttatatttgaaactaaagatttagttataggctatgattcacctttaaca
aaacctttaaatataaaaatggaaagaggacaaaaggtagccttagtaggagccaatggt
cttggaaaaactacattactaaaaagtttattaggagctataaaaccattggaaggggat
gttacgctaggtgattatcaatacataggatattttgagcaagaagaaagagaatctaat
tataatacctgtatagaagaagtgtggaaagagttccctgtatttactcaatacgaaata
agatctgccctagcaaaatgtggattaactacgaagcaattagaatctaaaatagtagtg
ctgtccggtggagaagcagcaaaggtaaggctttgtaaaatactaaatagagaaaccaat
atactaatattagacgaacctactaaccacttagatgtggaagccaaagaagaattaaaa
agagcattaagagaatataaaggttctatacttttagtttgccacgaaaaagaattttat
gaagatatagtaacagaaacttggaattgtgaaagttggactacaaagattgtgtaa

DBGET integrated database retrieval system