KEGG   Clostridium botulinum A Hall: CLC_1790Help
Entry
CLC_1790          CDS       T00575                                 

Definition
(RefSeq) [Fe] hydrogenase
  KO
K00336  NADH-quinone oxidoreductase subunit G [EC:1.6.5.3]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00190  Oxidative phosphorylation
cbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    CLC_1790
Enzymes [BR:cbh01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     CLC_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe_hyd_lg_C Fe_hyd_SSU Fer2_4 NADH-G_4Fe-4S_3 Fer2 Fer4 Fer4_9 Fer4_21 Fer4_7 Fer4_6 Fer4_10 Fer4_16 Fer4_8 Fer4_3 Fer4_17 Fer4_15 Fer4_22 Fer4_18
Motif
Other DBs
NCBI-GeneID: 5400379
NCBI-ProteinID: YP_001387645
UniProt: A5I2X0
Position
complement(1898579..1900312)
Genome map
AA seq 577 aa AA seqDB search
MSLVTLNINGKDLKVENGTTILDAAKLLNINIPTLCNFHLNDNKTENKPGSCRVCVVEVE
GRKNLAPACCTPVGEGMIVKTNSIRAIKARRAIVELLLSDHPKDCLLCEKNTKCELQKLA
ADMGIREMKYQGDVSMYPIDISSYSIVRDMDKCILCRRCITICNEVQTVGTLSAIGRGFE
TVVAPAFSEAIKNTNCTFCGQCVSVCPTGALTEVNNTSKVWDALSQKDKIVIVQTAPAIR
AALGEEFGLEPGTTVTGKMVAALRQLGFSKVFDTDFAADLTIMEEASEFIHRLEHGGTLP
MLTSCCPGWIKFFEHNFNDLMDIPSSCKSPQQMFGAIAKSYLAEKMKVDPKDIIVVSVMP
CLAKKYEAKREEMKRNGIPDVDIVISTRELAKMIVEAGIDFNSLQEEEFDNPLGESTGAS
VIFGTTGGVMEAALRTAYEWVTKGTLKDVEFIEVRGEDGIREATVNIKDTEVKVAIASGL
GNARKLLNDIRNGKSKYHMIEIMACPSGCVDGGGQPYIYGDTNILKKRTEALYKEDSNKE
IRKSHENPYIKKLYEEYLGKPYGEKAHELLHTKYRVR
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagtaactttaaatataaatggtaaagatcttaaagtagaaaatggaactact
atattagatgcagcaaaacttttaaatataaatataccaactctatgtaattttcatctt
aatgataataaaacagaaaataaacctggttcctgtagggtctgtgtagtagaagtagaa
gggagaaaaaacttagcgccagcatgttgtacccctgtaggggaaggaatgatagtaaaa
actaattccataagggctataaaagctagaagagctatagtagaattacttttatctgat
catccaaaagactgtttgctttgtgagaaaaatacaaaatgtgagctacaaaaattagct
gcagatatgggtataagagaaatgaaatatcaaggtgatgtttcaatgtatcctatagat
atttctagctattccatagttagggatatggataaatgtatactttgtagaagatgcata
actatatgtaatgaagttcaaactgtaggaaccctatctgctattggaagaggttttgaa
actgtagtagcaccagccttttctgaagctataaaaaatactaattgtactttctgtgga
caatgtgtttctgtctgtccaactggggctttaacagaagtaaataatacaagtaaagtt
tgggatgctctatcacaaaaggataaaattgttattgtacaaacagctccagctattaga
gctgctttaggtgaagaatttggattagaacctggaacaactgttacaggaaaaatggta
gcggctcttcgtcaattaggattcagtaaagtttttgatacagattttgcagcagacttg
actattatggaggaagcttcagaatttattcatagattagaacatggcggaacacttcca
atgcttacaagttgttgtccaggatggataaaattctttgaacacaactttaatgattta
atggatataccatctagttgtaaatcacctcagcaaatgtttggagctatagctaaaagt
tatttagcagaaaaaatgaaggtagatcctaaagatattatagtagtatctgtaatgcct
tgtcttgctaaaaagtatgaggcaaaaagagaagaaatgaagagaaatggaatccctgat
gttgatattgttataagtacaagagaattagctaaaatgatagtagaagcgggtatagat
tttaattctctacaggaggaagaatttgataatcccctaggtgaatctacaggggcttca
gtaatttttggaactaccggcggtgttatggaagcggctttaagaactgcctatgaatgg
gttactaaaggtactttaaaagatgtagaatttatagaagttcgcggtgaagatggtata
agagaagctacagtaaacataaaggatacagaggttaaagtagctatagctagtggatta
ggtaatgctagaaagcttttaaatgatataagaaatggaaagtctaaatatcatatgatc
gaaatcatggcgtgtccatcaggatgtgtagatggtggtggtcaaccttatatctatgga
gatacaaatatattgaaaaaaagaacagaagccctatataaagaagatagtaataaagaa
ataaggaagtctcacgaaaatccatatataaagaaactttatgaagaatatttaggtaaa
ccttatggtgaaaaagctcatgaacttcttcatactaaatatagagttagataa

DBGET integrated database retrieval system