KEGG   Clostridium botulinum A Hall: CLC_1791Help
Entry
CLC_1791          CDS       T00575                                 

Definition
(RefSeq) [Fe] hydrogenase, electron-transfer subunit
  KO
K00335  NADH-quinone oxidoreductase subunit F [EC:7.1.1.2]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00190  Oxidative phosphorylation
cbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CLC_1791
Enzymes [BR:cbh01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     CLC_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_51K NADH_4Fe-4S 2Fe-2S_thioredx Fer4 SLBB Fer4_21 Fer4_2 Fer4_6 Fer4_10 Fer4_7 Fer4_9 Fer4_4 Fer4_8 FANCI_S1-cap Fer4_16 Fer4_17
Motif
Other DBs
NCBI-GeneID: 5399798
NCBI-ProteinID: YP_001387646
UniProt: A5I2X1
Position
complement(1900332..1902227)
Genome map
AA seq 631 aa AA seqDB search
MEKINSYKELKSYYENYKDLLKSRHTTHEEETAVENKKCERLILVCGGTGCKSADSDKIV
ENLKEEINKLGLQEEVKVSITGCFGFCEKGPIVKINPDNVFYVKVTPEDAKEIAEKHLLK
DEVVERLLYEEPTLKEKVKRQDEMSFYKKQKRIALRNCGLINPEDIKECIGLEGYLALGK
VLSEMTPDELIKLITDSGLRGRGGGGFSTGKKWSFGKMYDSDVKYIICNADEGDPGAFMD
RSILEGDPHSIIEAMAIAGYAIGASEGRIYIRAEYPLAVNRLKIAMDQAKECGLLGENIL
GTGFNFNIEIKYGAGAFVCGEETALIHSIEGERGEPTYKPPFPAEAGLWNKPTVVNNVET
LANIPAIINRGADWYKSIGTEKSNGTKVFALAGKINNVGLVEVPMGTTLREIIYDIGGGI
KNGKKFKAVQTGGPSGGCIPASLLDIPIDYESLTSIGSMMGSGGMIVMDEDNCMVDIAKF
YLEFTVDESCGKCTPCRIGNKRLLETLIKITNGKGSEEDLNKLDELSHIIKDTSLCGLGQ
TAPNPVLSTMRYFMDEYKAHVDEKRCPSGTCKNLLHYEITDKCIGCTKCARGCPVSCIIG
KVKEKHFINQEKCIKCGNCYSACPVGAIIKK
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaattaattcttataaagaattgaaaagctattatgaaaactataaggattta
ttaaaaagtagacataccacccatgaagaagaaacagcagtagaaaataaaaaatgtgaa
agacttatattagtttgtggcggtacaggatgtaaatcagctgacagtgataaaattgta
gaaaatttaaaagaagaaataaataaattaggactccaagaagaagtaaaagtttctatt
acaggatgctttggtttctgtgaaaaaggtcctatagttaaaataaatccagataatgtt
ttttatgttaaagtaacaccagaagatgctaaagaaatagcagaaaagcatttattaaaa
gatgaagtagtagaaagattactttatgaagaaccaacacttaaagaaaaagtaaaaaga
caagatgaaatgtctttttacaaaaaacaaaaaagaattgctcttagaaattgtgggctt
ataaatccagaagacataaaagaatgtatcggcttagagggatacttagccctaggaaaa
gttttaagtgaaatgacaccggatgaattaataaaattaataactgactcaggccttaga
ggaagaggcggcggtggcttctctacaggtaaaaaatggagttttggaaaaatgtatgat
agtgatgttaaatatataatatgtaatgcagatgaaggtgatccaggagcctttatggat
cgttccatattagaaggagatcctcatagcataattgaagctatggctatagctggctat
gccataggagcttctgaaggtcgtatatatataagagcagaatatcctttagctgtaaat
agattaaaaatagctatggatcaagctaaagagtgtggtcttttaggagaaaatatttta
ggcaccggttttaactttaatatagaaataaaatatggtgcaggagccttcgtatgtggg
gaagagacagcattaatacactccatagaaggagaaaggggagaacctacttataaacca
ccattcccagcagaagctggtctttggaataagccaacagtagtaaataatgtagaaacc
ttagcaaatatacctgccataataaataggggagcagattggtataaatccataggaaca
gaaaaatcaaatggtacaaaagttttcgcactagcagggaaaataaataatgttggatta
gttgaagttcctatggggactactctaagagagataatatatgatataggtggaggtata
aaaaacggcaagaaatttaaagctgttcaaacaggaggaccttcaggtggatgtattcca
gcttcacttttagatattcctatagactatgaatcattaacatctatagggtctatgatg
ggttccggtggaatgattgttatggatgaagataattgcatggtagatatagcaaaattt
tatcttgaatttacagtggatgaatcctgtggtaaatgtaccccatgtagaattggtaat
aagagacttttagaaactttaataaagataaccaatgggaagggttcagaagaagattta
aataaattagatgaattatcacatataataaaggatacttccttatgtggattaggacaa
actgcaccaaatccagtactaagtactatgagatattttatggatgaatacaaagctcac
gttgatgaaaaaagatgtccatcaggtacttgtaaaaatttactccattatgagattact
gataaatgtatcggatgtactaaatgtgcaagaggttgcccagtatcctgtataatagga
aaagttaaagaaaaacattttataaatcaagaaaaatgtattaaatgtggaaattgttat
agcgcttgtccagttggggctattataaagaaatag

DBGET integrated database retrieval system