KEGG   Clostridium botulinum A Hall: CLC_1792Help
Entry
CLC_1792          CDS       T00575                                 

Definition
(RefSeq) Fe] hydrogenase, electron-transfer subunit
  KO
K00334  NADH-quinone oxidoreductase subunit E [EC:1.6.5.3]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00190  Oxidative phosphorylation
cbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CLC_1792
Enzymes [BR:cbh01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     CLC_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2Fe-2S_thioredx HIRAN
Motif
Other DBs
NCBI-GeneID: 5400218
NCBI-ProteinID: YP_001387647
UniProt: A5I2X2
Position
complement(1902239..1902718)
Genome map
AA seq 159 aa AA seqDB search
MCSNELANTKFKELEEYINNISNKKGSLIEVLHKAQHIFGYLPNEVQEFVAKKLDISVSK
VYGVITFYSYFTTEPKGENVINVCMGTACFVKGAGDVLSEFENKLNIKVGETTKDGKFTL
QVLRCVGACGLAPVVTINDKVYGHFTKNEVDKVLEEYGA
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtgttccaatgagttagcaaataccaaattcaaagaactagaagaatatataaacaat
atctccaataagaaaggatcccttatagaagtgcttcataaggctcaacatatttttgga
tatcttccaaatgaagtgcaggaatttgtagctaaaaagctagacatttctgtttcaaag
gtttacggagttattactttttactcttattttactacagaaccaaagggtgaaaatgtt
ataaatgtctgtatgggcacagcttgctttgtaaagggagctggggatgtactttcagaa
tttgaaaataaattaaatataaaagttggagaaaccactaaagatggtaaatttacatta
caagttttaagatgtgtaggggcctgtggattagctccggtggttacaattaatgataag
gtatatggacattttactaaaaatgaagtagataaagtattggaagaatatggggcgtag

DBGET integrated database retrieval system