KEGG   Clostridium botulinum A Hall: CLC_1798Help
Entry
CLC_1798          CDS       T00575                                 

Gene name
ytfJ
Definition
(RefSeq) sporulation protein YtfJ
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_YtfJ DUF2652
Motif
Other DBs
NCBI-GeneID: 5398328
NCBI-ProteinID: YP_001387653
UniProt: A5I2X8
Position
1908862..1909302
Genome map
AA seq 146 aa AA seqDB search
MDGHPIENLMKNTMENIKDMIDVNTIVGDALNSPDGTTIVPISKVSFGFASGGSEYLSEK
QNENDLNYPFGGGSGAGVTVKPVAFLVIKGDQIRLLSVDHKNTYEKLIDNVPQIMDMLKD
KFGYNKKEDDYEKDSSCDCNFNNHEI
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggatggtcatcctattgaaaatttaatgaaaaataccatggaaaacataaaagatatg
atagatgtaaatacaattgtaggtgatgctttaaatagtcctgatggtactacaattgta
cctatatctaaggtttcctttggttttgcttctggtggttccgagtatttatctgaaaaa
caaaatgaaaatgatttaaattatccttttggtggtggttctggagcgggtgttactgta
aaaccagtagcttttttagtaataaaaggtgatcagataagacttttatctgtagatcat
aaaaatacttatgaaaaattaatagataatgtacctcaaataatggatatgttaaaagat
aagtttggttataataaaaaagaagatgattatgagaaagattctagctgcgattgtaat
tttaacaatcatgaaatctaa

DBGET integrated database retrieval system