KEGG   Clostridium botulinum A Hall: CLC_1806Help
Entry
CLC_1806          CDS       T00575                                 

Gene name
pdp
Definition
(RefSeq) pyrimidine-nucleoside phosphorylase
  KO
K00756  pyrimidine-nucleoside phosphorylase [EC:2.4.2.2]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00240  Pyrimidine metabolism
cbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CLC_1806 (pdp)
Enzymes [BR:cbh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.2  pyrimidine-nucleoside phosphorylase
     CLC_1806 (pdp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 5398261
NCBI-ProteinID: YP_001387661
UniProt: A5I2Y6
Position
complement(1915243..1916547)
Genome map
AA seq 434 aa AA seqDB search
MRMYDLILKKRNGGELSKEEIDYFILEYTNGNVPDYQASALLMAIYFQKMKRRETVDLTM
AMVNSGDILDLSKIQGIKVDKHSTGGVGDTTTLVLAPMVAALGIPVAKMSGRGLGHTGGT
IDKLESFKGFSVNMTEDKFINNVNNIKIAVGAQTADLAPADKKLYALRDVTATVDNISLI
ASSIMSKKIAAGANAIILDVKVGEGAFMKTPETAKELAEEMVNIGKSVGRNTVAILSDMD
QPLGYAIGNALEVKEAIDTLKGKGPKDLLELCLTLGSNMVILSQKANTIEEARKMLLSTI
EKGLAIEKLKEFIRSQGGDGTLVDNTEKLPKAEYIIPVICDRNGYINKIHAQNIGIIASE
LGAGRVTKDSIIDLAVGIVLNKKRSDKVKKGDIIAYIHANDKIKGEKAAKDILNNYVIEE
ELKEELPLIYGTVK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgtatgatttgatcctaaagaaaagaaatggaggagagctaagcaaagaagaa
atagattattttattttagaatatactaatggtaatgtcccagattatcaagcttcagct
cttttaatggctatatactttcaaaaaatgaaaagaagagaaactgtagatttgactatg
gctatggttaactctggagatatattggatttatcaaaaatacagggtataaaagttgat
aaacatagtactggtggagttggagatactactaccttagttttggcgcctatggtagca
gccttaggtatacctgtagctaaaatgtctggtagaggtttaggtcatactggtggaact
atagataaattagaatcttttaaaggtttttcagtaaatatgacagaggataaatttata
aataacgttaacaatattaaaatagctgtaggagctcaaacagcagatttagctccagcg
gataaaaaattatatgcattaagagatgttactgctacagtagacaatatttctttaata
gcttctagtataatgagcaaaaaaatagctgcaggagctaatgccataattttagatgta
aaggttggagaaggagccttcatgaaaactccggaaactgcaaaagagttagcggaagaa
atggttaatataggtaaaagtgtaggcagaaatactgtggctatattatcagatatggat
caacctttaggttatgctataggaaatgctttagaagtaaaagaagctatagatacacta
aaaggtaaaggtcctaaggatttattagaattatgtttaaccttaggaagtaatatggtt
attttatcacaaaaagcaaatactatagaggaagcaagaaagatgcttttaagtactata
gaaaaaggattagctatagaaaaattaaaagaatttattagatctcaaggcggagatggt
actttagtagacaatacagaaaaattacctaaggcagaatatataattcctgtaatttgt
gatagaaatggatatataaataaaattcatgcccaaaatatagggataatagcatcagag
ttaggagcaggaagggttacaaaggatagcattatagatttagcagtaggtatagttttg
aacaagaagagatcagataaagttaaaaaaggagatataatagcttatattcatgctaat
gataaaataaaaggagaaaaggctgcaaaagatatattaaataattatgttatagaagaa
gagttaaaagaagaattacctttaatatatggtacagtaaaatag

DBGET integrated database retrieval system