KEGG   Clostridium botulinum A Hall: CLC_1814Help
Entry
CLC_1814          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adaptin_binding DUF1192 Tmemb_cc2 Secretin_N_2 Hep_59
Motif
Other DBs
NCBI-GeneID: 5401293
NCBI-ProteinID: YP_001387669
UniProt: A5I2Z4
Position
complement(1925029..1925643)
Genome map
AA seq 204 aa AA seqDB search
MKFNGWNSFEDLARACGYTDSHKDSDNTSETSNNNATNESCNMGCYDIPNGFQSLNPQLF
VAIGGILGDILAGSIPANVQVALGNWLLLVGQAIVTFNAQQIYFQQGPGRYFNPQNYNVD
NPFCQTTSQNTTQNNSSSKNSKNSSKDSKDSNKDSKNSSKSKEKNPNSDGKSSSKNKVDK
IEELELRIDQLMSEMERIKNKIEK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaatggctggaatagttttgaggacttagcgagagcttgcggatatactgac
tctcataaggatagtgataatacaagtgaaacaagtaacaataatgcaacaaatgaatct
tgtaatatgggatgctatgatatacctaatggatttcaatctttaaatccccagttattc
gttgcaataggaggaatacttggagatatattagcaggcagtattcctgctaatgttcaa
gttgcacttggaaattggttactgttagttggccaggcaattgtaacatttaatgctcaa
caaatatattttcaacaaggaccggggagatattttaatcctcagaattataatgtagat
aatccattttgccaaactacttctcaaaatactactcagaataatagctcaagcaagaat
agtaaaaattcaagtaaggatagtaaagattcaaataaggatagtaaaaattcaagcaaa
agtaaagaaaaaaacccgaattctgatggaaaatcatctagtaaaaataaagttgataaa
atagaggagctagagttacgtatagatcagctaatgtctgagatggagagaattaaaaat
aaaattgaaaaataa

DBGET integrated database retrieval system