KEGG   Clostridium botulinum A Hall: CLC_1815Help
Entry
CLC_1815          CDS       T00575                                 

Definition
(RefSeq) phage integrase site specific recombinase
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Phage_int_SAM_5 Phage_int_SAM_1 Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 5400385
NCBI-ProteinID: YP_001387670
UniProt: A5I2Z5
Position
complement(1925779..1926573)
Genome map
AA seq 264 aa AA seqDB search
MRYLEEEKNIIDINKINKEIVQEYIMFTRNRGKYSFVASIDGMIKANIDKRSDIGEQVSD
ATLNNYLRNIKVFFYWLDENHIIKKNTVCKCKFLKTERKSKEQLTDEEFKKLTRSINITK
FHEYRDFVINLIIDTGMRLSETLHLTINDVDFSRRTILIPAEINKGRKDRVIFYGNTMSK
LLHRWIRFKDIYQETELLFPTHRTNTILRSCDSTDFITFAEDLFHQQFYLVKVKQRFRLL
ILANPQYLNYLYMSLLYLIKNNNT
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcttgaagaagaaaagaatattatagatattaataagattaataaagaaatc
gtccaagaatatattatgtttacaagaaatagaggcaaatatagtttcgttgcaagcata
gatggaatgattaaagctaacattgataaaagaagtgatataggagaacaagtatcagat
gctacattaaataattatttaagaaatattaaagtgtttttttattggttagatgagaat
catataattaaaaagaatacagtatgtaaatgtaaatttttaaaaactgagagaaaaagt
aaagaacaattaacagatgaagaatttaaaaaattaacaagatcaataaacattacaaaa
tttcatgaatatagggactttgttattaacttaatcatagatacaggtatgagattaagc
gaaacattacatttaacaataaatgatgtagactttagtagaagaactattctaattcca
gcagaaataaataaaggacgtaaagatagagttattttttatggtaacacgatgtctaaa
ttactacatcgttggattaggtttaaagacatatatcaagaaacagaattgttgtttcct
acacatagaaccaacacaatattaagaagttgtgatagtactgattttataacatttgca
gaagatttatttcatcagcagttttatcttgtgaaagtgaaacagcgatttcgtttgcta
attttagcaaatcctcagtacttaaattatttatatatgtcattgttatacctaattaaa
aataataatacataa

DBGET integrated database retrieval system