KEGG   Clostridium botulinum A Hall: CLC_1826Help
Entry
CLC_1826          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF21 DUF3784 TMEM43
Motif
Other DBs
NCBI-GeneID: 5401270
NCBI-ProteinID: YP_001387681
UniProt: A5I306
Position
complement(1939254..1939823)
Genome map
AA seq 189 aa AA seqDB search
MGNKKDNKKDNKKSDSKVNVKWVLTIVTWSVIFSGSISLVSDVLLDNVNLLVAFIILIFI
ILIGIIFDIIGVAVTASNETPFHAKAANKVPGAKLAVTFIRNAEKVSSFCNDVIGDVCGI
VSGSIGIIITSKILSLNSTLNSTVVTTGIGVTIGALTIGGKALGKGFAITNSNDILEKVT
RIIYFFKRG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaataaaaaagataataaaaaagataataagaagagtgactccaaggtcaatgta
aaatgggtcttaaccattgttacatggtctgttattttttcagggagtatatctcttgtt
tcagatgtgctactagataatgtaaacttattagtagcttttattatattaatttttatt
atattaattggtataatatttgatataataggagttgcagtaactgcatccaatgaaaca
ccttttcatgcaaaagctgctaataaagtaccaggagcaaaactcgcagtaacttttatt
agaaatgcagaaaaggtatcaagtttttgcaatgatgttataggagacgtctgtggtatt
gtaagtggttctatagggataataataacaagtaaaatattatctttaaattctacttta
aattctacagtagtaactacaggtataggtgttaccataggagctttaactataggggga
aaagctttaggtaaaggatttgctataacaaatagtaatgatatattagaaaaggttaca
aggataatatatttttttaaaagaggatag

DBGET integrated database retrieval system