KEGG   Clostridium botulinum A Hall: CLC_1828Help
Entry
CLC_1828          CDS       T00575                                 

Gene name
xseB
Definition
(RefSeq) exodeoxyribonuclease VII small subunit
  KO
K03602  exodeoxyribonuclease VII small subunit [EC:3.1.11.6]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    CLC_1828 (xseB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cbh03400]
    CLC_1828 (xseB)
Enzymes [BR:cbh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     CLC_1828 (xseB)
DNA repair and recombination proteins [BR:cbh03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA exonucleases
     CLC_1828 (xseB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_VII_S YkyA FH2 COMM_domain Profilin
Motif
Other DBs
NCBI-GeneID: 5398243
NCBI-ProteinID: YP_001387683
UniProt: A5I308
Position
complement(1941621..1941836)
Genome map
AA seq 71 aa AA seqDB search
MEKKKESFENMLEKLETIVDSMDNGEITLEDSMKSYEEGIKLCNKLYKVLKDAEGKIKIL
ENNKEEDFENS
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaagaaagaatcctttgaaaatatgcttgagaaattagaaactatagtggac
agtatggataatggagaaataaccttagaagattccatgaaaagttatgaagaaggaata
aaattatgtaataaattatataaagtactaaaagatgcagaaggtaaaataaagatttta
gaaaataacaaagaggaagattttgaaaactcatag

DBGET integrated database retrieval system