KEGG   Clostridium botulinum A Hall: CLC_1834Help
Entry
CLC_1834          CDS       T00575                                 

Gene name
spoIIIAF
Definition
(RefSeq) stage III sporulation protein AF
  KO
K06395  stage III sporulation protein AF
Organism
cbh  Clostridium botulinum A Hall
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    CLC_1834 (spoIIIAF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_III_AF CemA
Motif
Other DBs
NCBI-GeneID: 5401182
NCBI-ProteinID: YP_001387689
UniProt: A5I314
Position
complement(1945602..1946192)
Genome map
AA seq 196 aa AA seqDB search
MLQWLKEWITNIAVAVFFITAIEMLLPKNNIKKYGKFVLGLILITVILNPIIKIFNKDYN
ISQYVEKATASFNNVDYKNDFDKYKKKNREETLNNFKANLQNQTKKRLEEKFPENKYEVN
VEIAYDEEKDNLEIKSMDVGVKGNKIEKIKKVNKINIGSNENGKEDKKSFEGEGKIKQFI
SNEFKVSSEVIKVYKL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttgctccaatggttaaaagagtggataactaatatagctgtagcagtattttttataact
gccatagagatgcttttacccaaaaataatataaaaaagtacggaaaatttgttcttgga
ttaatattaataactgtaatattaaatccaataataaaaatatttaataaagattataat
atatcacagtatgtagagaaggctacagcttcctttaataatgtagactataaaaatgat
tttgataaatacaaaaaaaagaatagagaggaaactttaaataactttaaagctaatctt
caaaatcaaactaaaaaaaggttagaagaaaagtttccagaaaacaaatatgaggtaaat
gtagaaattgcttatgatgaagaaaaggataatttggaaataaaatctatggatgtagga
gtaaaggggaataaaatagaaaaaatcaaaaaagtaaacaaaataaatataggcagcaat
gaaaatggaaaagaggataaaaagagctttgaaggagaaggtaagataaaacagtttata
agcaatgaatttaaggtatcctctgaagtaataaaagtatataaattataa

DBGET integrated database retrieval system