KEGG   Clostridium botulinum A Hall: CLC_1837Help
Entry
CLC_1837          CDS       T00575                                 

Definition
(RefSeq) stage III sporulation protein AC
  KO
K06392  stage III sporulation protein AC
Organism
cbh  Clostridium botulinum A Hall
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    CLC_1837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIIAC DUF2304
Motif
Other DBs
NCBI-GeneID: 5398761
NCBI-ProteinID: YP_001387692
UniProt: A5I317
Position
complement(1947810..1948007)
Genome map
AA seq 65 aa AA seqDB search
MLDIQLIFKIAGVSILVIILDKILKSSGKDDYAVVTNLAGIVVILMMVINLINKLFNAVK
TMFQI
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgctagacatacagttgatttttaagatagcaggagtaagcatattggttataattttg
gataaaatattaaaatctagtggtaaagatgattatgcagtggtaactaacttagcaggt
atagttgtaatacttatgatggtaataaatttgataaataaattatttaatgcagtaaaa
accatgttccaaatttaa

DBGET integrated database retrieval system