KEGG   Clostridium botulinum A Hall: CLC_1839Help
Entry
CLC_1839          CDS       T00575                                 

Definition
(RefSeq) stage III sporulation protein AA
  KO
K06390  stage III sporulation protein AA
Organism
cbh  Clostridium botulinum A Hall
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    CLC_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA
Motif
Other DBs
NCBI-GeneID: 5401593
NCBI-ProteinID: YP_001387694
UniProt: A5I319
Position
complement(1948605..1949528)
Genome map
AA seq 307 aa AA seqDB search
MYTEEILNILPSHISRLICDLDEVDKLQEIRFKIGKPIFFQIGNIEKLASYEVKREDIKS
IVQRMSNYSIYSFEEEIKQGYLTIKGGHRVGICGRCVIDEGKVKTIRDISSLNIRICREI
YNASKLVMPYIVENGHVLNTIIISPPKCGKTTIIRDISKKISDGVDALNLKGKKVSVIDE
RSEIAGSYNGVPQLDVGLRTDVLDNCPKSEGIVMAIRSMAPEVIICDEIGTYNDVESILI
ALNSGVSLITTIHGFGVEDIYNRPVFKEIVENKVFKRAIVLSSKKSVGTLEYVYDFNKKT
KLYCRII
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttgtatacagaagagattctaaatatacttccaagtcatataagtagattaatatgtgat
ttagatgaagtagataaacttcaagaaataaggtttaaaattgggaaacctatatttttc
caaataggcaatatagagaagcttgcatcttatgaagtgaaaagagaggatataaaatct
atagttcaaagaatgagtaattattctatttatagttttgaagaagaaataaaacaggga
tatctaactataaaaggcggtcatagagttggcatatgtggtagatgtgtaatagatgaa
ggcaaagttaaaactataagagatataagttctttaaatataagaatttgtagagaaata
tataatgcctcaaagctagttatgccctatatagtagaaaatggacatgttttaaatact
ataataatttctcctcctaaatgtgggaagaccactataataagggatatatctaaaaaa
atatctgatggagtggatgcgttaaatttaaaagggaaaaaagtatctgttatagatgaa
agaagtgaaatagctgggagctataatggtgttccccaattagatgtaggtttaaggacg
gatgtcttagataattgtcctaaaagtgaaggcatagtaatggctataagaagtatggca
ccagaagtaataatatgtgatgaaataggaacttataatgatgtagaaagtatacttatc
gctttaaattcaggagtcagcctaataacgaccatacatggctttggagtagaagatatt
tacaataggcccgtttttaaagaaatagtagaaaataaagtttttaaaagagctatagtt
ttaagctctaaaaaatctgtaggtactttagagtatgtatatgattttaacaagaaaacc
aagctttactgtagaataatttaa

DBGET integrated database retrieval system