KEGG   Clostridium botulinum A Hall: CLC_2156Help
Entry
CLC_2156          CDS       T00575                                 

Definition
(RefSeq) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00260  Glycine, serine and threonine metabolism
cbh01100  Metabolic pathways
cbh01110  Biosynthesis of secondary metabolites
cbh01120  Microbial metabolism in diverse environments
cbh01130  Biosynthesis of antibiotics
cbh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLC_2156
Enzymes [BR:cbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CLC_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 5400873
NCBI-ProteinID: YP_001388002
UniProt: A5I404
Position
complement(2293422..2294450)
Genome map
AA seq 342 aa AA seqDB search
MYSFKCDYSEGCHPRILKALAESNITQEEGYGKDSHTKNAISIIKKLVQNENVDIHLISG
GTQTNLISISSFLRPHEACICVHSGHIAGPETGSIEYTGHKVITVDSTNGKITTDKIQQV
LDFHINEHFVKPKLVYISNSTEVGTVYTKEEMRNLSEFCKKKNLILYVDGARLGSALAVK
ESNLTLKDMCGFSDAFCIGGTKNGALIGEALVIKNQNLKEDFRYNIKQKGALLAKGRVLG
IQFEELFKDNLYFDLANHANEMASILTKGLKDANCKFFVESKSNQIFPILSNENIKILQE
RFSFNIWEKVDNKNSAIRLVTSWATTKEAVFEFIQELKQLVE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtatagttttaaatgcgattatagtgaaggatgtcatcctagaattttaaaggcatta
gcagagtcaaatattactcaagaggaaggttatggaaaagattctcatactaaaaatgct
atttctataataaagaaattagtacaaaatgaaaatgtagatattcatcttatatctgga
ggaactcaaacaaatttaatttcgattagctcatttttaagacctcatgaagcttgtata
tgtgtacattcaggtcatattgcaggccccgagactggttccattgaatatactggtcat
aaagtaattactgtagattcaaccaatggaaaaattactacagataaaattcagcaggta
ttagattttcatataaacgagcattttgtaaaaccaaagcttgtttatatttctaattca
acagaagtgggaacagtatataccaaagaagaaatgagaaatttaagtgaattttgtaaa
aagaagaaccttattttgtatgtagatggtgcaaggcttggttccgctcttgctgttaaa
gagtcaaatttaactttaaaagatatgtgtggtttttcagatgcattttgtattggtggg
actaaaaatggggctcttataggagaagctttagttataaaaaatcaaaatttaaaagaa
gattttagatataatataaaacaaaaaggagctcttcttgctaagggaagagttttagga
atacaatttgaggagctatttaaggataatctttattttgatcttgcaaatcatgcaaat
gaaatggcaagcattttaactaaaggattaaaagatgccaactgtaagttttttgtggaa
tctaagagtaatcaaattttccctattctgagtaatgaaaacataaaaatactacaagaa
agattctcttttaatatttgggagaaggtagacaataaaaattccgctattagattagtt
acttcctgggcaacaacaaaagaagcagtatttgaatttattcaagaattaaaacaatta
gtggaatag

DBGET integrated database retrieval system