KEGG   Clostridium botulinum A Hall: CLC_2369Help
Entry
CLC_2369          CDS       T00575                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00230  Purine metabolism
cbh01100  Metabolic pathways
Module
cbh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CLC_2369 (gmk)
Enzymes [BR:cbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CLC_2369 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 Cytidylate_kin dNK AAA_22 AAA_28 RsgA_GTPase ABC_tran AAA_16 Rad17 ADK MMR_HSR1 AAA_17 ATP-synt_ab AAA_29
Motif
Other DBs
NCBI-GeneID: 5399279
NCBI-ProteinID: YP_001388212
UniProt: A5I4U2
Position
complement(2494856..2495485)
Genome map
AA seq 209 aa AA seqDB search
MAKKGLLIVISGPSGAGKGTICKELLKKEDLWVSVSATTRSPRKGEENGVHYFFLNKDEF
NERIEKDDFLEYAKVHQNLYGTPKSSVLEKINNGNNVILEIDIQGALKVKETYPEGIFIF
ILPPSMEELKNRIINRGSETAETLMIRFKAAYKEINYVSKYNYAVVNDTVEDAVNKVRSI
ILAESCRVDRMKDTILASKEEFIHEQFYD
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaggacttcttatagttatttctggaccatctggtgcaggaaaaggaact
atatgcaaagaacttttaaaaaaggaagacctatgggtatcagtttctgccaccactaga
tctccaagaaagggagaggaaaatggagtacattattttttcttaaataaagatgaattt
aatgaaagaatagagaaagatgattttttagaatatgctaaagttcatcaaaatttatat
ggaactcctaaatctagtgttttagaaaagattaataatggtaataatgtaatattagag
atagatattcaaggagctttaaaagtaaaagaaacttatccagaaggaatatttatattt
atattgcctccttctatggaagaattaaaaaatagaataataaatagaggcagtgaaaca
gcagaaactttaatgataagatttaaagctgcttacaaagaaataaattatgtatcaaaa
tataattatgcagtagtaaatgatacagtggaggacgcagttaataaggtaagaagtatt
atattagcggaaagctgtagagttgatagaatgaaggatacaatattagcatcaaaggag
gaatttattcatgagcaattctatgattaa

DBGET integrated database retrieval system