KEGG   Clostridium botulinum A Hall: CLC_2763Help
Entry
CLC_2763          CDS       T00575                                 

Gene name
ribAB
Definition
(RefSeq) bifunctional riboflavin biosynthesis protein RibAB
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00740  Riboflavin metabolism
cbh00790  Folate biosynthesis
cbh01100  Metabolic pathways
cbh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CLC_2763 (ribAB)
   00790 Folate biosynthesis
    CLC_2763 (ribAB)
Enzymes [BR:cbh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CLC_2763 (ribAB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     CLC_2763 (ribAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 NapD
Motif
Other DBs
NCBI-GeneID: 5398671
NCBI-ProteinID: YP_001388598
UniProt: A5I5V0
Position
complement(2914468..2915673)
Genome map
AA seq 401 aa AA seqDB search
MSYKFNTIEEAIEDIKDGKIIVVVDDEDRENEGDLLMAAEKITPEAINFMAKEGRGLICT
PVKKSRLEELEICQMVHKNKDNFGTAFTVSVDAVGTSTGISAFDRAFTVSKIVDLNSKPE
DFLKPGHVFPLAAKDGGVLVRAGHTEAAVDMARLSGFSEVGVICEIMNEDGTMARVPQLM
EFVKKHNLKIITIADLIEYRSKEEKLIKALEPVKLPSKYGDFIAIGYENLITGEEHIALV
KGDVKGEDPVLVRVHSECLTGDVFGSLRCDCGEQIAKALMKIEEEGKGVLVYMRQEGRGI
GLLNKLKAYALQDEGMDTIEANLALGFPEDLRDYGIGAQILKDLGIKNIKLMTNNPKKIS
GLSGYGIKIVDRVPIDMGCKKENRNYLRTKKDKMGHLIDIM
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagttataaatttaatactatagaagaggcaatagaggatataaaagatggaaagatt
attgtagttgtagatgatgaggatagagagaacgagggagatcttttaatggcagcagaa
aaaattactccagaggctataaattttatggctaaagagggaagagggcttatatgtact
cccgtaaaaaaatctagattagaggaattagaaatatgccaaatggtacataagaataaa
gataattttggtaccgcttttactgtatcagtagatgcagtaggtacatctactggaata
tctgcatttgatagagcatttacagtatcaaaaatagtagatctaaattcaaaaccagag
gattttttaaagccaggccatgtatttcctttagctgctaaagatggaggagttttagtt
agagcaggtcatacagaagcggcagtagatatggcaagattatcaggcttttctgaggta
ggagttatatgtgaaataatgaatgaggacggaactatggcaagagtgccacaacttatg
gaatttgtaaaaaaacataatttaaaaataataactatagcagatttaattgaatataga
agtaaagaagaaaaactaataaaggctttagaaccagtaaaacttccatctaaatatgga
gactttattgctataggttatgaaaatttaataactggagaagaacatatagctttagta
aaaggagatgtaaaaggagaagatccagtacttgttagagtacattcagaatgtttaaca
ggagatgtattcggttctttaagatgcgattgtggtgagcaaatagctaaagctcttatg
aaaatagaagaagaagggaaaggggttttagtttatatgagacaggaagggagaggaata
ggtttattaaataaactaaaggcatatgctcttcaagatgaaggtatggatactatagaa
gcaaatttagctttaggattcccagaggacttaagagattatggcataggagctcaaata
ttaaaggatttagggatcaaaaatattaaacttatgactaataatcctaaaaaaatatca
ggactttcaggttatggtataaaaatagtagatagagttcctatagatatgggctgtaaa
aaagaaaatcgtaattatttaagaactaagaaagataaaatgggacacttgatagacata
atgtag

DBGET integrated database retrieval system