KEGG   Clostridium botulinum A Hall: CLC_3110Help
Entry
CLC_3110          CDS       T00575                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00071  Fatty acid degradation
cbh00280  Valine, leucine and isoleucine degradation
cbh00310  Lysine degradation
cbh00362  Benzoate degradation
cbh00380  Tryptophan metabolism
cbh00620  Pyruvate metabolism
cbh00630  Glyoxylate and dicarboxylate metabolism
cbh00640  Propanoate metabolism
cbh00650  Butanoate metabolism
cbh00900  Terpenoid backbone biosynthesis
cbh01100  Metabolic pathways
cbh01110  Biosynthesis of secondary metabolites
cbh01120  Microbial metabolism in diverse environments
cbh01130  Biosynthesis of antibiotics
cbh01200  Carbon metabolism
cbh01212  Fatty acid metabolism
cbh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLC_3110
   00630 Glyoxylate and dicarboxylate metabolism
    CLC_3110
   00640 Propanoate metabolism
    CLC_3110
   00650 Butanoate metabolism
    CLC_3110
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLC_3110
   00072 Synthesis and degradation of ketone bodies
    CLC_3110
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLC_3110
   00310 Lysine degradation
    CLC_3110
   00380 Tryptophan metabolism
    CLC_3110
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLC_3110
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLC_3110
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLC_3110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbh04147]
    CLC_3110
Enzymes [BR:cbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLC_3110
Exosome [BR:cbh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLC_3110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 5398355
NCBI-ProteinID: YP_001388929
Position
complement(3282012..3283190)
Genome map
AA seq 392 aa AA seqDB search
MKNVVIASAVRTPIGKFGGTLKSVSAIELGSIVIKEALKRANVKPEDVDEVIMGNVLQAG
LGQNSTRQSAVAAGIPVEVPSFTINKVCGSGLRAVSLATQLIKLGDDDIVVAGGTENMSA
APYLLEKARWGQRMGDGKIVDEMIRDGLWESFNDYHMGITAENIAEQWGITREEQDEFSA
KSQQKAEKAVKEGRFKEEIVPVVIKSRKGEVVFDTDEFPRFGATKESLSKLKPAFKKDGT
VTAGNASGINDGAAALVIMSEEKANELGIKPLAKIVAYGTSGVDPKIMGYGPFYATKKTL
EKANLKIADMDLIEANEAFAAQSLAVAKDLGFDMDKVNVNGGAIALGHPIGCSGARILTT
LLYEMEKRNSKHGLATLCIGGGMGTAIIVERY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttgttattgctagtgctgtaagaacacctataggaaaatttggaggaaca
ttaaaaagtgtttcagctatagaattaggaagtattgttattaaagaagctttaaaaaga
gctaatgtaaaaccagaagatgttgatgaggttataatgggtaatgtacttcaagcaggt
cttggtcaaaactcaacaagacaatctgcagtagcggcaggtataccagtagaagtacca
agctttacaataaataaggtttgtggttcaggacttagagcagtaagtttagcaactcaa
ttaataaaactcggagatgacgatatagtagtagcaggtggtacagaaaatatgtctgca
gctccatatcttttagaaaaagcaagatggggacagagaatgggagatggaaaaattgta
gacgagatgataagagatggactatgggaatcttttaatgactatcatatgggaattacg
gctgaaaatatagcagagcaatggggaataacaagagaagagcaagacgaattttcagct
aaatcacaacaaaaagcagagaaagctgtaaaagaaggaagatttaaagaggaaatagta
ccagtagttattaaaagtagaaaaggcgaagtagtatttgatactgatgaatttcctaga
tttggtgctactaaagagagcctttctaaattaaaaccagctttcaaaaaagatggaaca
gttacagctggtaatgcttcaggtataaatgatggagcagctgctttagttatcatgagt
gaagaaaaggcaaatgaattaggaattaaacctttagctaaaatagttgcttatggtaca
agtggagtagatccaaagataatggggtatggaccattttatgcaactaaaaaaacttta
gaaaaagccaacctaaaaatagcagatatggatttaatagaagcaaatgaagcttttgcg
gctcaaagtttagcagtagctaaagatctaggttttgatatggataaagtaaatgtaaat
ggtggagctatagctttaggacatccaattggatgctcaggggctagaatattaactact
ttattatatgaaatggaaaaaagaaattcaaaacatggcttagctaccttatgtataggc
ggtggaatgggaacagctattattgttgaaagatattaa

DBGET integrated database retrieval system